Basic Information | |
---|---|
Family ID | F090121 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | LHTSRHTRKNSDFSTQDEHLVLLGLEALTETPNLRYATRS |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.16 % |
% of genes near scaffold ends (potentially truncated) | 84.26 % |
% of genes from short scaffolds (< 2000 bps) | 89.81 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.037 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.444 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 2.78 |
PF05598 | DUF772 | 1.85 |
PF01555 | N6_N4_Mtase | 0.93 |
PF00496 | SBP_bac_5 | 0.93 |
PF07681 | DoxX | 0.93 |
PF01656 | CbiA | 0.93 |
PF13586 | DDE_Tnp_1_2 | 0.93 |
PF13701 | DDE_Tnp_1_4 | 0.93 |
PF13385 | Laminin_G_3 | 0.93 |
PF13551 | HTH_29 | 0.93 |
PF02445 | NadA | 0.93 |
PF12804 | NTP_transf_3 | 0.93 |
PF00044 | Gp_dh_N | 0.93 |
PF13546 | DDE_5 | 0.93 |
PF01610 | DDE_Tnp_ISL3 | 0.93 |
PF13340 | DUF4096 | 0.93 |
PF03400 | DDE_Tnp_IS1 | 0.93 |
PF03458 | Gly_transporter | 0.93 |
PF01844 | HNH | 0.93 |
PF03811 | Zn_Tnp_IS1 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.78 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.78 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.78 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.78 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.78 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.78 |
COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.93 |
COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 0.93 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.93 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.93 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.93 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.93 |
COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.93 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.93 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.96 % |
Unclassified | root | N/A | 12.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886007|SwRhRL2b_contig_2059622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 930 | Open in IMG/M |
3300000550|F24TB_10094406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 619 | Open in IMG/M |
3300000559|F14TC_100068721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1426 | Open in IMG/M |
3300000559|F14TC_102109357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 512 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1004276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1651 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1007935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1187 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1001056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1698 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1004760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 927 | Open in IMG/M |
3300000754|JGI11851J11668_1000290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1653 | Open in IMG/M |
3300000858|JGI10213J12805_10124413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1434 | Open in IMG/M |
3300000953|JGI11615J12901_10084778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 791 | Open in IMG/M |
3300001661|JGI12053J15887_10153282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1208 | Open in IMG/M |
3300002558|JGI25385J37094_10093058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 909 | Open in IMG/M |
3300002561|JGI25384J37096_10091732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1079 | Open in IMG/M |
3300002568|C688J35102_120490042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1112 | Open in IMG/M |
3300002907|JGI25613J43889_10026315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1647 | Open in IMG/M |
3300002908|JGI25382J43887_10300864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 702 | Open in IMG/M |
3300003203|JGI25406J46586_10116033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 790 | Open in IMG/M |
3300003659|JGI25404J52841_10129648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 533 | Open in IMG/M |
3300004016|Ga0058689_10155252 | Not Available | 530 | Open in IMG/M |
3300004081|Ga0063454_100498092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 855 | Open in IMG/M |
3300004463|Ga0063356_101206565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1099 | Open in IMG/M |
3300005186|Ga0066676_11005248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 554 | Open in IMG/M |
3300005289|Ga0065704_10110264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. PCC 7425 | 1984 | Open in IMG/M |
3300005294|Ga0065705_10009645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5190 | Open in IMG/M |
3300005294|Ga0065705_10165632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1737 | Open in IMG/M |
3300005295|Ga0065707_10122812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2080 | Open in IMG/M |
3300005332|Ga0066388_103904759 | Not Available | 760 | Open in IMG/M |
3300005446|Ga0066686_10385739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 957 | Open in IMG/M |
3300005467|Ga0070706_100735952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 914 | Open in IMG/M |
3300005556|Ga0066707_10378011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 924 | Open in IMG/M |
3300005559|Ga0066700_10901489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 587 | Open in IMG/M |
3300005561|Ga0066699_10452170 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300005713|Ga0066905_101732659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 575 | Open in IMG/M |
3300005719|Ga0068861_100175297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1780 | Open in IMG/M |
3300005764|Ga0066903_100653422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1839 | Open in IMG/M |
3300005764|Ga0066903_102518819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 996 | Open in IMG/M |
3300005764|Ga0066903_103540814 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300005764|Ga0066903_106339789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
3300005937|Ga0081455_10145399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1835 | Open in IMG/M |
3300006797|Ga0066659_11277146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 612 | Open in IMG/M |
3300006845|Ga0075421_100317536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1889 | Open in IMG/M |
3300006845|Ga0075421_101379760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 776 | Open in IMG/M |
3300006845|Ga0075421_102318221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 564 | Open in IMG/M |
3300006853|Ga0075420_100199050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1750 | Open in IMG/M |
3300006854|Ga0075425_100434621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1511 | Open in IMG/M |
3300006854|Ga0075425_101159166 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300006871|Ga0075434_102034539 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006880|Ga0075429_100181269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1845 | Open in IMG/M |
3300006969|Ga0075419_10059192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2415 | Open in IMG/M |
3300007258|Ga0099793_10048857 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
3300009090|Ga0099827_10385633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Haliea → unclassified Haliea → Haliea sp. | 1196 | Open in IMG/M |
3300009090|Ga0099827_10995039 | Not Available | 727 | Open in IMG/M |
3300009100|Ga0075418_11220261 | Not Available | 815 | Open in IMG/M |
3300009147|Ga0114129_10144278 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
3300009553|Ga0105249_10319788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1563 | Open in IMG/M |
3300010366|Ga0126379_13097895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 556 | Open in IMG/M |
3300011270|Ga0137391_10265836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1484 | Open in IMG/M |
3300012202|Ga0137363_11262205 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 626 | Open in IMG/M |
3300012205|Ga0137362_10880151 | Not Available | 766 | Open in IMG/M |
3300012207|Ga0137381_10255312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1524 | Open in IMG/M |
3300012350|Ga0137372_10255846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1375 | Open in IMG/M |
3300012353|Ga0137367_10143490 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300012357|Ga0137384_10643971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 863 | Open in IMG/M |
3300012363|Ga0137390_10413877 | Not Available | 1326 | Open in IMG/M |
3300012469|Ga0150984_108200001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2281 | Open in IMG/M |
3300012532|Ga0137373_10995346 | Not Available | 607 | Open in IMG/M |
3300012929|Ga0137404_10441437 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1153 | Open in IMG/M |
3300015053|Ga0137405_1029455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1111 | Open in IMG/M |
3300016422|Ga0182039_12268968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 501 | Open in IMG/M |
3300019233|Ga0184645_1162813 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1210 | Open in IMG/M |
3300019259|Ga0184646_1421236 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300021073|Ga0210378_10221179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 720 | Open in IMG/M |
3300025910|Ga0207684_10060454 | All Organisms → cellular organisms → Bacteria | 3218 | Open in IMG/M |
3300026313|Ga0209761_1088754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1578 | Open in IMG/M |
3300026320|Ga0209131_1086086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1685 | Open in IMG/M |
3300026529|Ga0209806_1194067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 716 | Open in IMG/M |
3300027846|Ga0209180_10162700 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300027873|Ga0209814_10051512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1718 | Open in IMG/M |
3300027880|Ga0209481_10065247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1712 | Open in IMG/M |
3300027882|Ga0209590_10300509 | Not Available | 1030 | Open in IMG/M |
3300027882|Ga0209590_10662269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 669 | Open in IMG/M |
3300027907|Ga0207428_10154386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1746 | Open in IMG/M |
3300027909|Ga0209382_10090035 | All Organisms → cellular organisms → Bacteria | 3605 | Open in IMG/M |
3300028536|Ga0137415_10093627 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
3300028608|Ga0247819_10081067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1591 | Open in IMG/M |
3300028799|Ga0307284_10066992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1293 | Open in IMG/M |
3300030336|Ga0247826_11247923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 597 | Open in IMG/M |
3300031094|Ga0308199_1089155 | Not Available | 664 | Open in IMG/M |
3300031421|Ga0308194_10204789 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300031421|Ga0308194_10212261 | Not Available | 632 | Open in IMG/M |
3300031421|Ga0308194_10301815 | Not Available | 555 | Open in IMG/M |
3300031751|Ga0318494_10882938 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300031770|Ga0318521_10461211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 761 | Open in IMG/M |
3300031777|Ga0318543_10218690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 847 | Open in IMG/M |
3300031797|Ga0318550_10057359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1764 | Open in IMG/M |
3300031912|Ga0306921_10356269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1710 | Open in IMG/M |
3300031942|Ga0310916_10570943 | Not Available | 962 | Open in IMG/M |
3300031945|Ga0310913_10454036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 910 | Open in IMG/M |
3300032035|Ga0310911_10780480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 552 | Open in IMG/M |
3300032052|Ga0318506_10076667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1396 | Open in IMG/M |
3300032060|Ga0318505_10055171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1714 | Open in IMG/M |
3300032060|Ga0318505_10249391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 835 | Open in IMG/M |
3300032076|Ga0306924_11601913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 686 | Open in IMG/M |
3300032174|Ga0307470_10912895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 691 | Open in IMG/M |
3300033289|Ga0310914_10157784 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2006 | Open in IMG/M |
3300034644|Ga0370548_037832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 817 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.19% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 9.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.56% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL2b_0118.00005720 | 2162886007 | Switchgrass Rhizosphere | VHTLWSIRKNSGFSTQEEHLGLLGVEALTNALNLRYATRSIY |
F24TB_100944062 | 3300000550 | Soil | LHTSGHTRKSSSFSTQDEHLVLLGLEALTNVPNLRYATR |
F14TC_1000687211 | 3300000559 | Soil | LHTSGHTRKSSSFSTQDEHLVLLGLEALTNVPNLRYAT |
F14TC_1021093571 | 3300000559 | Soil | VHTLWYSRKNSGFSTQEEHLVLLGLEALTNALNLRYATRS |
KanNP_Total_noBrdU_T14TCDRAFT_10042762 | 3300000596 | Soil | MGLHTSRHTRKTSSFSTQDEPLVLLGLEALTGVSNLHYATRSIY |
KanNP_Total_noBrdU_T14TCDRAFT_10079351 | 3300000596 | Soil | LHTSGHTRKSSSFSTQDEHLVLLGLEALTNVPNLRYATRSI |
KanNP_Total_F14TBDRAFT_10010563 | 3300000709 | Soil | MGLHTSRHTRKTSSFSTQDEPLVLLGLEALTGVSNLHYATRS |
KanNP_Total_F14TBDRAFT_10047601 | 3300000709 | Soil | VHTPRHIRKNSGFSTQEEHIVLLGLEALTGTPNLRYATRSN |
JGI11851J11668_10002902 | 3300000754 | Soil | VHTPRHIRKNSGFSTQEEHIVLLGLEALTGTPNLRYATRSI |
JGI10213J12805_101244131 | 3300000858 | Soil | MGLHTSRHTRKNSSFSTQGKRIGLLGLEALPYAAHLHYATRS |
JGI11615J12901_100847782 | 3300000953 | Soil | MGLHTSRHTRKTSSFSTQDEPLVLLGLEALTGVSNLHYATRSN* |
JGI12053J15887_101532822 | 3300001661 | Forest Soil | LHTPRHTRKNSSFSTQDEHLGLLGLEALTETPNLHYATRS |
JGI25385J37094_100930581 | 3300002558 | Grasslands Soil | LHTSRHTRKNSGFSTQDEPLGLLGLEALTEAPNFHYATRS |
JGI25384J37096_100917322 | 3300002561 | Grasslands Soil | LHTSRHTRKNSDFSTQDEHLVLLGLEALTETPNLRYATRS |
C688J35102_1204900421 | 3300002568 | Soil | MHTSRHSRKNSSFSTQGEHLVLLGLEALTEASNLRYATRS |
JGI25613J43889_100263151 | 3300002907 | Grasslands Soil | LHTSRHTSKNSSFSTQDEHLMLLGLEALTDAPNLRYATRSX |
JGI25382J43887_103008642 | 3300002908 | Grasslands Soil | LHTSRHTRKNSXFSTQXEPLGLLGLEALTEAPNFHYATRSXXSV |
JGI25406J46586_101160331 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MGLHTSRHTRKNSSFSTQDEHLVLLGLEALTAAPNLRYATRSIY |
JGI25404J52841_101296481 | 3300003659 | Tabebuia Heterophylla Rhizosphere | VHTSGHTRKNSSFSTQDEHQVLLGLEALTDVPNLRYATRSN |
Ga0058689_101552522 | 3300004016 | Agave | MGLHASRHTRKNSSFSTQVERLVLLGLEALTGVSNLHYVDTL* |
Ga0063454_1004980921 | 3300004081 | Soil | MHTSRHSRKNSSFSTQGEHLVLLGLEALTEASNLRYATRSTYVYELYQLHQI* |
Ga0063356_1012065651 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LHTSRHIRKDSGFSTQDEHRVLLGLEALTKAPNRRYATRS |
Ga0066676_110052481 | 3300005186 | Soil | MGLHTSRHTRKNSSFSTQDKRIVLLGLEALPYASHLHYATCS |
Ga0065704_101102641 | 3300005289 | Switchgrass Rhizosphere | VHTLWSIRKNSGFSTQEEHLGLLGVEALTNALNLRYATRSN* |
Ga0065705_100096457 | 3300005294 | Switchgrass Rhizosphere | RHIRKNSSFSTQDEHIVLLGLEALTETPNLRYATRPNYY* |
Ga0065705_101656322 | 3300005294 | Switchgrass Rhizosphere | VHTPRHIRKNSGFSTQDEHIGLLGLEALTETLYLRYATCS |
Ga0065707_101228123 | 3300005295 | Switchgrass Rhizosphere | VHTPRHIRENSGFSTQDEHSVLLGLEALTETLNLRYATRSTYRFHGT |
Ga0066388_1039047592 | 3300005332 | Tropical Forest Soil | AIRVHTPRHIRKNSGFSTQEEHIVLLGLEALTGTPNLRYATRSI* |
Ga0066686_103857392 | 3300005446 | Soil | LHTSRHTSKNSSFSTQDEHLMLLGLEALTDAPNLRYATRSTYRQRFFRSLQNGL |
Ga0070706_1007359524 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LHTSRHTKKNSSFSTQDEHLVLLGLEALTGVSNLHYATRSIYGGTLAEFQTC |
Ga0066707_103780111 | 3300005556 | Soil | LHTSRHTRKNSDFSTQDEHLVLLGLEALTETPNLRYATRSS* |
Ga0066700_109014892 | 3300005559 | Soil | HTSRHTRKNSDFSTQDEHLVLLGLEALPAALNLHYATRSK* |
Ga0066699_104521702 | 3300005561 | Soil | IGLHTSRHTRKNSSFSTQDEHRVLLGSEALTDAPNLRYATRST* |
Ga0066905_1017326592 | 3300005713 | Tropical Forest Soil | MASHTSRHTGKNSGFSTQDEHLVLLGLEALTDTSNFRSATRSN* |
Ga0068861_1001752971 | 3300005719 | Switchgrass Rhizosphere | VHTPRHIRENSGFSTQDEHSVLLGLEALTETLNLRYATRS |
Ga0066903_1006534221 | 3300005764 | Tropical Forest Soil | VHTSGHTRKHSSFSTQDEHLVLLGLEALIDVPNLRYATRS |
Ga0066903_1025188193 | 3300005764 | Tropical Forest Soil | HTSGHTRKHSSFSTQDEHLVLLGLEALIDVPNLRYATRST* |
Ga0066903_1035408143 | 3300005764 | Tropical Forest Soil | TSGHTRKHSSFSTQDEHLVLLGLEALIDVPNLRYATRSI* |
Ga0066903_1063397891 | 3300005764 | Tropical Forest Soil | MGSHTSRHTGKNSEFSTQDEHLVLLGLEALTDISNFRSATRSI* |
Ga0081455_101453992 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MHTPRHIRKNSGFSTQDEHIVLLGLEALTETPNLRYATRSI* |
Ga0066659_112771461 | 3300006797 | Soil | MGSHTSRHTGKNSGFSTQDEHLVLLGLEALTDTSNFRSATRS |
Ga0075421_1003175362 | 3300006845 | Populus Rhizosphere | LHTSVHTRKNSSFSTQDEHLVLLGLEALTNVPNLRYATRSS* |
Ga0075421_1013797602 | 3300006845 | Populus Rhizosphere | MHSSRHSRKNSSFSTQGEPLVLLGLEALTEASNLRYATRST* |
Ga0075421_1023182211 | 3300006845 | Populus Rhizosphere | VHTPRHIRKNSSFSTQDEHIVLLGLEALTETPNLRYATRS |
Ga0075431_1010570182 | 3300006847 | Populus Rhizosphere | GEMGSHTSRHTGKNSGFSTQDEHLMLLGLEALTDTS* |
Ga0075420_1001990501 | 3300006853 | Populus Rhizosphere | MGLHTSSHTRKNSSFSTQDEHLLLLGLEALTGVSNLHYATRSI* |
Ga0075425_1004346212 | 3300006854 | Populus Rhizosphere | VHTPRHIRKNSGFSTQEEHIVLLGLEALTETPNLRYATRSK |
Ga0075425_1011591661 | 3300006854 | Populus Rhizosphere | NSGFSTQEEHLGLLGLEALTNALNLRYATRSKYYNAPLKG* |
Ga0075434_1020345391 | 3300006871 | Populus Rhizosphere | VHTLWYIRKNSGFSTQEEHLGLLGLEALTNALNLRYATRSKYYNAPLKG* |
Ga0075429_1001812691 | 3300006880 | Populus Rhizosphere | MGSHTSRHTGKNSGFSTQDEHLMLLGLEALTDTSNFRSATRSS |
Ga0075419_100591922 | 3300006969 | Populus Rhizosphere | MHSSRHSRKNSSFSTQGEPLVLLGLEALTEASNLRYATRSIYTRRRNLLENVDI* |
Ga0099793_100488571 | 3300007258 | Vadose Zone Soil | GEIGLHTSRHTRKNSSFSTQDKHLVLLGLEALTDAPNLRYATRSN* |
Ga0099827_103856332 | 3300009090 | Vadose Zone Soil | LHTSRDTRKNSVFSTQDEHLGLLGLEALTEALNFHYAKRSIYVVLFSCYLDS* |
Ga0099827_109950391 | 3300009090 | Vadose Zone Soil | RKNSVFSTQDEHLGLLGLEALTEALNFHYAKRSTY* |
Ga0075418_112202611 | 3300009100 | Populus Rhizosphere | TRKNSSFSTQGEHQVLLGLEALADGPNLRYATCSKYLGVS* |
Ga0114129_101442783 | 3300009147 | Populus Rhizosphere | MHSSRHSRKNSSFSTQGEHLVLLGLEALTEASNLRYATRST* |
Ga0105249_103197881 | 3300009553 | Switchgrass Rhizosphere | VHTPRHIRKNSGFSTQDEHIGLLGLEALTETLYLRYATCSN |
Ga0126379_130978952 | 3300010366 | Tropical Forest Soil | MASHTSRHTGKNSGFSTQDEHVVLLGWEALTEALYLRYATCSN |
Ga0137391_102658361 | 3300011270 | Vadose Zone Soil | GEIGLHTSRHTRKNSSFSTQDEHLVLLGLEALTEAPNPHYAVVSL* |
Ga0137363_112622051 | 3300012202 | Vadose Zone Soil | RHTRKNSSFSTQDEHLVLLGLKALTDAPNLSYATRSI* |
Ga0137362_108801511 | 3300012205 | Vadose Zone Soil | TRKNSSFSTQDEHPVLLGLEALTAVPNLRYATRSIYEMDI* |
Ga0137381_102553121 | 3300012207 | Vadose Zone Soil | MHTSRHSRKNSSFSTQGEHLVLLGLEALTEASNLRYATRSNY |
Ga0137372_102558461 | 3300012350 | Vadose Zone Soil | LHTSRHTSKNSSFSTQDEHLMLLGLEALTDAPNLRYATRS |
Ga0137367_101434903 | 3300012353 | Vadose Zone Soil | HTSRHTSKNSSFSTQDEHLMLLGLEALTDAPNLRYATRST* |
Ga0137384_106439712 | 3300012357 | Vadose Zone Soil | MSLHTSRHTRKNSSFSTQDEHLVLLGLEALTGVSNLHYA |
Ga0137390_104138773 | 3300012363 | Vadose Zone Soil | CGAIGLPTSRDTRKNSVFSTQDEHLGLLGLEALTEALNFHYATRSN* |
Ga0150984_1082000013 | 3300012469 | Avena Fatua Rhizosphere | MHTSRHSRKNSSFSTQGEHLVLLGLEALTEASNLRYATRSI* |
Ga0137373_109953461 | 3300012532 | Vadose Zone Soil | SKNSSFSTQDEHLMLLGLEALTDAPNLRYATRST* |
Ga0137404_104414371 | 3300012929 | Vadose Zone Soil | GLHTSRHTRKNSSFSTQDEHLVLLGLKALTDAPNLSYATRSK* |
Ga0137405_10294551 | 3300015053 | Vadose Zone Soil | LHTSRHTRKNSGFSTQDEHLVLLGLEALTEVPNLRYATRSTYYGLRTRS |
Ga0182039_122689682 | 3300016422 | Soil | MASHTSRHTGKNSGFATQDEHLVLLGLEALTDTSNFCPATRSIYPTP |
Ga0184645_11628131 | 3300019233 | Groundwater Sediment | TSRHIRKNSSFSTQDEHLVLLGLEALIDTPNLRYATRSK |
Ga0184646_14212363 | 3300019259 | Groundwater Sediment | LHTSRHIRKNSSFSTQDEHLVLLGLEALIDTPNLRYATRSK |
Ga0210378_102211792 | 3300021073 | Groundwater Sediment | LHTSRHIRKNSSFSTQDEHLVLLGLEALIDTPNLRYATRSIYPL |
Ga0207684_100604545 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MCFHILRHSRKNSDFSTQDEHLVLLGLASLTEAPHLRYATRSH |
Ga0209761_10887543 | 3300026313 | Grasslands Soil | LHTSRHTRKNSDFSTQDEHLVLLGLEALTETPNLRYAT |
Ga0209131_10860861 | 3300026320 | Grasslands Soil | LHTSRHTSKNSSFSTQDEHLMLLGLEALTDAPNLRYATRSSYIGVNK |
Ga0209806_11940671 | 3300026529 | Soil | MGLHTSRHTRKNSSFSTQDEHLVLLGLKALTDAPNLSYATRSRYTLVM |
Ga0209180_101627002 | 3300027846 | Vadose Zone Soil | GLHTSRHTSKNSRFSTQDEHLVLLGLEALTAAANLRYATRSSYLRQVER |
Ga0209814_100515121 | 3300027873 | Populus Rhizosphere | MHTSGHTRKNSSFSTQGEHQVLLGLEALADGPNLRYATCS |
Ga0209481_100652472 | 3300027880 | Populus Rhizosphere | MGLHTSRHTRKNSSFSTQDKHIVLLGLEALPYASHLHYATCSNYHK |
Ga0209590_103005091 | 3300027882 | Vadose Zone Soil | TRKNSSFSTQDEHLVLLGLEALTEAPNPHYATRSI |
Ga0209590_106622692 | 3300027882 | Vadose Zone Soil | MGLHTSRHTRKNSSFSTQDKHLVLLGLEALTDAPNSRYATRSIY |
Ga0207428_101543862 | 3300027907 | Populus Rhizosphere | MGLHTSSHTRKNSSFSTQDEHLLLLGLEALTGVSNLHYATRSR |
Ga0209382_100900354 | 3300027909 | Populus Rhizosphere | MHTSGHTRKNSSFSTQGEHQVLLGLEALADGPNLRYATCSTYEVALR |
Ga0137415_100936271 | 3300028536 | Vadose Zone Soil | SLHTSKHIRKDSGFSTQDEHRVLLGLEALTKAPNRRYATRST |
Ga0247819_100810672 | 3300028608 | Soil | LHTSVHTRKNSSFSTQDEHLVLLGVEALTNVPNLRYATRSTYHTP |
Ga0307284_100669923 | 3300028799 | Soil | LHTPRHTRKNSSFSTQDEHLVLLGLEALTEAPNLYYATRSTYQERD |
Ga0247826_112479231 | 3300030336 | Soil | LHTSVHTRKNSSFSTQDEHLVLLGVEALTNVPNLRYATRSK |
Ga0308199_10891551 | 3300031094 | Soil | HTSRHTRKNSSFSTQDEHPVLLGLEALTAVPNLRYATRSIYL |
Ga0308194_102047891 | 3300031421 | Soil | TRKNSGFSTQDEHRVLLGSEALTDAPNLRYATRSN |
Ga0308194_102122611 | 3300031421 | Soil | TRKNSSFSTQDEHLVLLGLEALTEAPNLYYATRST |
Ga0308194_103018151 | 3300031421 | Soil | HTRKNSSFSTQDEHLVLLGLEALTEAPNLYYATRSIYERQV |
Ga0318494_108829381 | 3300031751 | Soil | GVHTSGYTRKDSSFSTQDEHQVLLGLEALTDVPKLRYATRSN |
Ga0318521_104612112 | 3300031770 | Soil | VHTPRHIRKNSGFSTQGEHIVLLGLEALTETPDLRYATCSI |
Ga0318543_102186901 | 3300031777 | Soil | VHTPRHIRKNSGFSTQGEHIVLLGLEALTETPDLRY |
Ga0318550_100573592 | 3300031797 | Soil | VHTSGYTRKDSSFSTQDEHQVLLGLEALTDVPKLRYATRSNYS |
Ga0306921_103562691 | 3300031912 | Soil | VHTLRHSRKNSGFSTQDEHVVLLGWEALTEALYLRYATCSR |
Ga0310916_105709431 | 3300031942 | Soil | SLHTSRHIRKDSGFSTQDEHRVLLGLEALTKAPKRRYATRSK |
Ga0310913_104540361 | 3300031945 | Soil | VHTLRHSRKNSGFSTQDEHVVLLGWEALTEALYLRYATCSIYPKMLI |
Ga0310911_107804801 | 3300032035 | Soil | VHTPRHIRKNSGFSTQGEHIVLLGLEALTETPDLRYAT |
Ga0318506_100766671 | 3300032052 | Soil | LHTSRHIRKDSGFSTQDEHRVLLGLEALTKAPKRRYATRSNYAEARTSSS |
Ga0318505_100551712 | 3300032060 | Soil | VHTSGYTRKDSSFSTQDEHQVLLGLEALTDVPKLRYATRSTYRFHGTGRVCNSLM |
Ga0318505_102493911 | 3300032060 | Soil | VHTPRHIRKNSGFSTQGEHIVLLGLEALTETPDLRYATCSK |
Ga0306924_116019131 | 3300032076 | Soil | HSRKNSGFSTQDEHVVLLGWEALTEALYLRYATCSM |
Ga0307470_109128952 | 3300032174 | Hardwood Forest Soil | VHTPRHIRKNSGFSTQDEHIVLLGLEALTETPNLRY |
Ga0310914_101577841 | 3300033289 | Soil | GLHTSGHTRKHSSFSTQDEHLVLLGLEALTAVPNLRYATRSS |
Ga0370548_037832_2_124 | 3300034644 | Soil | RQRAYTRENSGFSTQDEHLGLLGLEALTEALNFHYATRST |
⦗Top⦘ |