NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089461

Metagenome / Metatranscriptome Family F089461

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089461
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 44 residues
Representative Sequence SWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW
Number of Associated Samples 95
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.25 %
% of genes from short scaffolds (< 2000 bps) 90.83 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.413 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.936 % of family members)
Environment Ontology (ENVO) Unclassified
(30.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 23.94%    Coil/Unstructured: 76.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF12544LAM_C 51.38
PF04055Radical_SAM 17.43
PF02776TPP_enzyme_N 4.59
PF02146SIR2 0.92
PF01551Peptidase_M23 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.41 %
UnclassifiedrootN/A4.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003911|JGI25405J52794_10094961All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300004480|Ga0062592_100908260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria794Open in IMG/M
3300005147|Ga0066821_1010468All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005165|Ga0066869_10104290All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300005332|Ga0066388_103447717All Organisms → cellular organisms → Bacteria → Proteobacteria807Open in IMG/M
3300005332|Ga0066388_107732780All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005356|Ga0070674_102103890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.515Open in IMG/M
3300005363|Ga0008090_10175721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300005363|Ga0008090_10208770All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005440|Ga0070705_100254817All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300005713|Ga0066905_102274627All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300005764|Ga0066903_107117675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300005764|Ga0066903_107496942All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005764|Ga0066903_109120511All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005842|Ga0068858_101635076All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300006048|Ga0075363_100997699All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300006163|Ga0070715_10366124All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300006175|Ga0070712_100490606All Organisms → cellular organisms → Bacteria → Proteobacteria1028Open in IMG/M
3300006604|Ga0074060_12002991All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300006845|Ga0075421_101460237All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300006914|Ga0075436_100407613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria986Open in IMG/M
3300009090|Ga0099827_10203770All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300010046|Ga0126384_10872091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.811Open in IMG/M
3300010046|Ga0126384_11373883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.658Open in IMG/M
3300010047|Ga0126382_11482292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium violaceum623Open in IMG/M
3300010360|Ga0126372_10370940All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300010362|Ga0126377_11190837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300010362|Ga0126377_11496066All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300010366|Ga0126379_10416471All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300010376|Ga0126381_100580801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1592Open in IMG/M
3300010376|Ga0126381_103561800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.611Open in IMG/M
3300010376|Ga0126381_104426155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.543Open in IMG/M
3300010376|Ga0126381_104677505All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010398|Ga0126383_13153741All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300010401|Ga0134121_10256561All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300012211|Ga0137377_10328393All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300012354|Ga0137366_10077038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2537Open in IMG/M
3300012354|Ga0137366_10320378All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300012917|Ga0137395_11236626All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012960|Ga0164301_11238325All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300012971|Ga0126369_10589228All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300015077|Ga0173483_10155323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1014Open in IMG/M
3300015359|Ga0134085_10593247All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300015371|Ga0132258_11812173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601538Open in IMG/M
3300016270|Ga0182036_11592091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.550Open in IMG/M
3300016270|Ga0182036_11746796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.526Open in IMG/M
3300016319|Ga0182033_11921090All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300016445|Ga0182038_12191353All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018061|Ga0184619_10521829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300018074|Ga0184640_10371479Not Available647Open in IMG/M
3300018083|Ga0184628_10048425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602142Open in IMG/M
3300018481|Ga0190271_11241354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria867Open in IMG/M
3300021078|Ga0210381_10304105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300021080|Ga0210382_10138743All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300021168|Ga0210406_11255130All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300021560|Ga0126371_12177617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300022756|Ga0222622_10253372All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300025923|Ga0207681_10136351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601822Open in IMG/M
3300025937|Ga0207669_10976760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300025960|Ga0207651_11322493All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026088|Ga0207641_10005658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes10639Open in IMG/M
3300026121|Ga0207683_10115259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602409Open in IMG/M
3300026550|Ga0209474_10412895Not Available698Open in IMG/M
3300026557|Ga0179587_10990286All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300027654|Ga0209799_1026262All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300027748|Ga0209689_1005258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68609263Open in IMG/M
3300027880|Ga0209481_10470865All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300028705|Ga0307276_10078752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria772Open in IMG/M
3300028707|Ga0307291_1066525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300028720|Ga0307317_10027630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1759Open in IMG/M
3300028722|Ga0307319_10054465All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300028824|Ga0307310_10503048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria610Open in IMG/M
3300031231|Ga0170824_115819062All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031474|Ga0170818_100890561All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031544|Ga0318534_10425826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300031544|Ga0318534_10716960All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031549|Ga0318571_10356127All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031561|Ga0318528_10032915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602558Open in IMG/M
3300031640|Ga0318555_10496544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria661Open in IMG/M
3300031682|Ga0318560_10512160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300031719|Ga0306917_10135163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601813Open in IMG/M
3300031720|Ga0307469_11772730All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031724|Ga0318500_10045461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601840Open in IMG/M
3300031744|Ga0306918_11051195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300031765|Ga0318554_10517842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300031769|Ga0318526_10043676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601688Open in IMG/M
3300031781|Ga0318547_10002871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606808Open in IMG/M
3300031792|Ga0318529_10151020All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300031793|Ga0318548_10436337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300031821|Ga0318567_10899195All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031879|Ga0306919_10481180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria956Open in IMG/M
3300031879|Ga0306919_10972417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300031890|Ga0306925_10771093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1000Open in IMG/M
3300031894|Ga0318522_10404331All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300031897|Ga0318520_11092399All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031946|Ga0310910_10819175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300031947|Ga0310909_11516198All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300032051|Ga0318532_10303741All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300032052|Ga0318506_10277629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300032055|Ga0318575_10140962All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300032063|Ga0318504_10062422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601597Open in IMG/M
3300032089|Ga0318525_10125543All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300032090|Ga0318518_10257425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300033290|Ga0318519_10080264All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300033433|Ga0326726_12326519All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300033551|Ga0247830_11108756All Organisms → cellular organisms → Bacteria632Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.83%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25405J52794_1009496123300003911Tabebuia Heterophylla RhizosphereTPACFSWAAGERIRLIAGDWNGRCIGAIFYNYARRTRCETWCGW*
Ga0062592_10090826013300004480SoilWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMSCGGSRW*
Ga0066821_101046823300005147SoilFVGRTPACWSWAAGEPIRLLAGDWNGRCDYAVFYNFYRRSTCEMSCGGSRW*
Ga0066869_1010429023300005165SoilTPACFSWAAGERIRLISGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW*
Ga0066388_10344771723300005332Tropical Forest SoilGWAPGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGGWW*
Ga0066388_10773278023300005332Tropical Forest SoilFSWAAGERIRLIAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW*
Ga0070674_10210389023300005356Miscanthus RhizosphereRTPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW*
Ga0008090_1017572123300005363Tropical Rainforest SoilAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW*
Ga0008090_1020877013300005363Tropical Rainforest SoilAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW*
Ga0070705_10025481723300005440Corn, Switchgrass And Miscanthus RhizosphereCWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW*
Ga0066905_10227462713300005713Tropical Forest SoilACFSWAAGERIRLIAGDWNGRCIGAIFYNYARRNRCETWCGW*
Ga0066903_10711767523300005764Tropical Forest SoilAGERIRLLAGDWNGRCVAARFYNFYRRNTCDMWCGGGGW*
Ga0066903_10749694223300005764Tropical Forest SoilSGKTPACLSWAAGEQITLVAGDWHGRCVDAVFYNYPRRSTCEVSCGWGRY*
Ga0066903_10912051123300005764Tropical Forest SoilSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW*
Ga0068858_10163507613300005842Switchgrass RhizosphereCWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW*
Ga0075363_10099769913300006048Populus EndosphereTPACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCQMLCGGSRW*
Ga0070715_1036612423300006163Corn, Switchgrass And Miscanthus RhizosphereFGWVAGERITLVAGDWNARCVVAVFYNFYRRNTCEMWCGGSGWW*
Ga0070712_10049060613300006175Corn, Switchgrass And Miscanthus RhizosphereCFGWVAGERITLVAGDWNARCVVAVFYNFYRRNTCEVWCGGGWW*
Ga0074060_1200299123300006604SoilWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEVWCGGGGWW*
Ga0075421_10146023723300006845Populus RhizosphereCLHWAAGERIRLIAGDWNGRCVGAIFYNYARRNRCEMWCGW*
Ga0075436_10040761313300006914Populus RhizosphereIRLIAGDWNGRCVAARFYNFYRRNTCEVSCGGGGWW*
Ga0099827_1020377013300009090Vadose Zone SoilRRFTAKTPACMRWAAGERIRLIAGDWNGRCVDAVFYNYFWRGTCEMWCGW*
Ga0126384_1087209133300010046Tropical Forest SoilGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW*
Ga0126384_1137388313300010046Tropical Forest SoilRIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW*
Ga0126382_1148229223300010047Tropical Forest SoilFTGWAPACFRWVAGERIRLIAGDWNGRCIGAIFYNYARRNRCEMWCGW*
Ga0126372_1037094023300010360Tropical Forest SoilRIRLIAGDWNGRCVAARFYNFYRRNTCDVSCGSGGWWW*
Ga0126377_1115031623300010362Tropical Forest SoilRITLIAGDWHGRCDAAVFYNYARHNTCEVSCGGGWW*
Ga0126377_1119083713300010362Tropical Forest SoilMRWAAGEPIRLIAGDWNGRCVDAIFYNYFWRSTCEMSCGRSWWY*
Ga0126377_1149606623300010362Tropical Forest SoilARTPACLGWAPGERIRLIAGDWNGRCVTAVFYNFYRRSTCEMWCGGGWW*
Ga0126379_1041647133300010366Tropical Forest SoilIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW*
Ga0126381_10058080133300010376Tropical Forest SoilTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW*
Ga0126381_10356180023300010376Tropical Forest SoilGWAAGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW*
Ga0126381_10442615513300010376Tropical Forest SoilTPACFSWAAGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGSWWW*
Ga0126381_10467750523300010376Tropical Forest SoilFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW*
Ga0126383_1315374123300010398Tropical Forest SoilFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW*
Ga0134121_1025656123300010401Terrestrial SoilTPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW*
Ga0137377_1032839313300012211Vadose Zone SoilCFAWAAGERIRLLAGDWNGRCVVALFYNFYRRNTCEMWCGGGWW*
Ga0137366_1007703833300012354Vadose Zone SoilGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGCWW*
Ga0137366_1032037823300012354Vadose Zone SoilCFGWAAGERIRLLAGDWNARCAVAVFYNFYRRNTCEMWCGSGWWW*
Ga0137395_1123662613300012917Vadose Zone SoilERIRLLAGDWNGRCVVALFYNFYRRNTCEMWCGGGWW*
Ga0164301_1123832513300012960SoilRITLVAGDWNARCAVAVFYNFYRRNTCEMWCGGGGWW*
Ga0126369_1058922813300012971Tropical Forest SoilARTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW*
Ga0075304_103526823300014307Natural And Restored WetlandsGEQIKLIEGDWNGRCVEAVFYNVWRRSTCVTVCEGNGWRWW*
Ga0173483_1015532313300015077SoilERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW*
Ga0134085_1059324713300015359Grasslands SoilRSPSCFGWAAGERIRLLAGDWNARCAVAVFYNFYRRNTCEMLCGSGWWW*
Ga0132258_1181217333300015371Arabidopsis RhizosphereWSWAAGERIKLLAGDWNARCDYAAFYNFYRRSTCEMWCGGSRW*
Ga0182036_1159209123300016270SoilTPACFSWAAGERIRLIAGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW
Ga0182036_1174679613300016270SoilARTPACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0182033_1192109023300016319SoilSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0182038_1219135313300016445SoilACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDMWCGGGGWW
Ga0184619_1052182913300018061Groundwater SedimentTGKSRACFNWAAGERIKLIAGDWNARCTEAVFYNFYRRSTCEMWCRPW
Ga0184640_1037147913300018074Groundwater SedimentFVGRSPACWSWAAGERIKLLAGNWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0184628_1004842513300018083Groundwater SedimentSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW
Ga0190271_1124135413300018481SoilACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW
Ga0210381_1030410513300021078Groundwater SedimentACWSWAAGEAIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0210382_1013874323300021080Groundwater SedimentRIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0210406_1125513013300021168SoilERITLVAGDWNARCVVAVFYNFYRRNTCEMWCGGGGWW
Ga0126371_1217761723300021560Tropical Forest SoilSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW
Ga0222622_1025337213300022756Groundwater SedimentGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0207681_1013635133300025923Switchgrass RhizosphereRTPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMLCGGSRW
Ga0207669_1097676013300025937Miscanthus RhizosphereTPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0207651_1132249323300025960Switchgrass RhizosphereACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCQMLCGGSRW
Ga0207641_1000565813300026088Switchgrass RhizosphereAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW
Ga0207683_1011525913300026121Miscanthus RhizosphereTPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW
Ga0209474_1041289513300026550SoilTPACFSWAAGERIALIAGDWHGRCIDAVFYNFARRSTCETWCH
Ga0179587_1099028623300026557Vadose Zone SoilARTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEVWCGGGGWW
Ga0209799_102626223300027654Tropical Forest SoilRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0209689_100525883300027748SoilRIRLIAGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW
Ga0209481_1047086523300027880Populus RhizosphereGMSPACFNWVAGERITLIAGDWNARCVGAVFYNFARRNRCEMLCGWRW
Ga0307276_1007875213300028705SoilTPACFSWVAGERITLVAGDWNAHCVVAVFYNFYRRNTCEMWCGGGGWW
Ga0307291_106652513300028707SoilAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0307317_1002763043300028720SoilRSPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0307319_1005446513300028722SoilAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW
Ga0307299_1004215113300028793SoilKSRACFNWAAGERIKLIAGDWNARCTEAVFYNFYRRSTCEMWCRPW
Ga0307310_1050304813300028824SoilSWAAGERIKLLAGNWNARCDYAVFYNLYRRSTCEMWCGGSRW
Ga0170824_11581906213300031231Forest SoilPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMSCGGSRW
Ga0170818_10089056113300031474Forest SoilPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW
Ga0318534_1042582613300031544SoilIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318534_1071696013300031544SoilFTALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318571_1035612713300031549SoilLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318528_1003291513300031561SoilFTARTPACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0318555_1049654413300031640SoilRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318560_1051216013300031682SoilRTPACFSWAAGERIGLIAGDWHARCVDAVFYNFSRRSTCETWCR
Ga0306917_1013516333300031719SoilERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0307469_1177273023300031720Hardwood Forest SoilTGWAPACFRWVAGERIRLIAGDWNGRCIGAIFYNYARRNRCEMWCGW
Ga0318500_1004546133300031724SoilPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0306918_1105119513300031744SoilERIRLIAGDWNGRCVDARFYNFYRRNTCDVWCGSGGWWW
Ga0318554_1051784223300031765SoilCISWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318526_1004367613300031769SoilLIGGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318547_1000287163300031781SoilTPACFSWAAGERIRLLAGDWNGRCVTAVFYNFYRRSTCEMWCGGSWWW
Ga0318529_1015102013300031792SoilRLSAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW
Ga0318548_1043633713300031793SoilAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318567_1089919513300031821SoilSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0306919_1048118013300031879SoilIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0306919_1097241713300031879SoilRIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0306925_1077109313300031890SoilAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0318522_1040433123300031894SoilTRFTALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318520_1109239923300031897SoilRIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0310910_1081917523300031946SoilFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0310909_1151619823300031947SoilATAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW
Ga0318532_1030374113300032051SoilLSAGDWNGRCVAARFYNFYRRYTCDVWCGSGGWWW
Ga0318506_1027762923300032052SoilRTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW
Ga0318575_1014096213300032055SoilTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318504_1006242233300032063SoilHQRRPLHGATAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318525_1012554313300032089SoilTALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318518_1025742523300032090SoilRIRLIVGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW
Ga0318519_1008026413300033290SoilFTARTPACFSWAAGERIRLLAGDWNGRCVTAVFYNFYRRSTCEMWCGGSWWW
Ga0326726_1232651913300033433Peat SoilAAGERIRLVAGDWNGQCVDAVFYNVWRRSTCEMWCRAWW
Ga0247830_1110875613300033551SoilFVGQTPACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.