NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089394

Metagenome / Metatranscriptome Family F089394

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089394
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 40 residues
Representative Sequence MTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS
Number of Associated Samples 73
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.04 %
% of genes near scaffold ends (potentially truncated) 64.22 %
% of genes from short scaffolds (< 2000 bps) 87.16 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.468 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.853 % of family members)
Environment Ontology (ENVO) Unclassified
(30.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.541 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.18%    β-sheet: 0.00%    Coil/Unstructured: 58.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF13602ADH_zinc_N_2 4.59
PF02899Phage_int_SAM_1 2.75
PF13489Methyltransf_23 1.83
PF12680SnoaL_2 1.83
PF02371Transposase_20 1.83
PF00211Guanylate_cyc 1.83
PF00144Beta-lactamase 1.83
PF02796HTH_7 1.83
PF08241Methyltransf_11 1.83
PF03641Lysine_decarbox 0.92
PF13185GAF_2 0.92
PF04892VanZ 0.92
PF00106adh_short 0.92
PF08271TF_Zn_Ribbon 0.92
PF13561adh_short_C2 0.92
PF01329Pterin_4a 0.92
PF08281Sigma70_r4_2 0.92
PF01569PAP2 0.92
PF12902Ferritin-like 0.92
PF01243Putative_PNPOx 0.92
PF01966HD 0.92
PF01494FAD_binding_3 0.92
PF03640Lipoprotein_15 0.92
PF00872Transposase_mut 0.92
PF00589Phage_integrase 0.92
PF14230DUF4333 0.92
PF13551HTH_29 0.92
PF00296Bac_luciferase 0.92
PF06689zf-C4_ClpX 0.92
PF12681Glyoxalase_2 0.92
PF01872RibD_C 0.92
PF00465Fe-ADH 0.92
PF02687FtsX 0.92
PF13340DUF4096 0.92
PF08240ADH_N 0.92
PF01863YgjP-like 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 2.75
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 2.75
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.83
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.83
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.83
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.83
COG2367Beta-lactamase class ADefense mechanisms [V] 1.83
COG3547TransposaseMobilome: prophages, transposons [X] 1.83
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.92
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.92
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.92
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.92
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.92
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.92
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 0.92
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.92
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 0.92
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.92
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.92
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.92
COG2154Pterin-4a-carbinolamine dehydrataseCoenzyme transport and metabolism [H] 0.92
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.92
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.47 %
UnclassifiedrootN/A38.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig814081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1023Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig935921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300000754|JGI11851J11668_1003111Not Available688Open in IMG/M
3300000858|JGI10213J12805_10296638Not Available617Open in IMG/M
3300000956|JGI10216J12902_100408702Not Available708Open in IMG/M
3300000956|JGI10216J12902_102950851All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300000956|JGI10216J12902_104334667Not Available723Open in IMG/M
3300001431|F14TB_100326320All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300003373|JGI25407J50210_10008554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2582Open in IMG/M
3300003373|JGI25407J50210_10034829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300005562|Ga0058697_10047297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces atratus1637Open in IMG/M
3300005562|Ga0058697_10240527Not Available839Open in IMG/M
3300005562|Ga0058697_10398645Not Available682Open in IMG/M
3300005719|Ga0068861_100746499Not Available914Open in IMG/M
3300005981|Ga0081538_10003151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia15679Open in IMG/M
3300006169|Ga0082029_1168741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli840Open in IMG/M
3300009156|Ga0111538_10551728Not Available1461Open in IMG/M
3300009789|Ga0126307_10217440All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300009789|Ga0126307_11003268Not Available675Open in IMG/M
3300009810|Ga0105088_1036285Not Available807Open in IMG/M
3300009840|Ga0126313_10003680All Organisms → cellular organisms → Bacteria8874Open in IMG/M
3300009840|Ga0126313_10598764All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300009840|Ga0126313_11167357Not Available634Open in IMG/M
3300009840|Ga0126313_11393155All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010029|Ga0105074_1020925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300010036|Ga0126305_10113629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1643Open in IMG/M
3300010037|Ga0126304_10429068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia884Open in IMG/M
3300010038|Ga0126315_10246038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1090Open in IMG/M
3300010038|Ga0126315_10477238All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010038|Ga0126315_11084080Not Available540Open in IMG/M
3300010041|Ga0126312_10197098Not Available1407Open in IMG/M
3300010041|Ga0126312_10431780All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300010041|Ga0126312_11347448Not Available529Open in IMG/M
3300010045|Ga0126311_10120373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis1831Open in IMG/M
3300010045|Ga0126311_10402058All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300010145|Ga0126321_1276515All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300010145|Ga0126321_1352689Not Available516Open in IMG/M
3300010145|Ga0126321_1462145Not Available600Open in IMG/M
3300010166|Ga0126306_10138859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1795Open in IMG/M
3300010166|Ga0126306_10949345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300010166|Ga0126306_10955255Not Available697Open in IMG/M
3300010395|Ga0058701_10554932Not Available643Open in IMG/M
3300011003|Ga0138514_100101757Not Available623Open in IMG/M
3300012021|Ga0120192_10000132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales5215Open in IMG/M
3300012021|Ga0120192_10031975All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia876Open in IMG/M
3300012204|Ga0137374_10843608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300012211|Ga0137377_10486900All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300012355|Ga0137369_10229344Not Available1417Open in IMG/M
3300012360|Ga0137375_11446405Not Available508Open in IMG/M
3300012941|Ga0162652_100053035All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae663Open in IMG/M
3300013306|Ga0163162_11778976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidiphila704Open in IMG/M
3300014487|Ga0182000_10001188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4878Open in IMG/M
3300014487|Ga0182000_10067922All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300014487|Ga0182000_10375536Not Available622Open in IMG/M
3300017965|Ga0190266_10575008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → Catellatospora citrea675Open in IMG/M
3300018051|Ga0184620_10031936Not Available1388Open in IMG/M
3300018075|Ga0184632_10215751Not Available843Open in IMG/M
3300018422|Ga0190265_11044042Not Available938Open in IMG/M
3300018422|Ga0190265_11571173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300018466|Ga0190268_12064119Not Available527Open in IMG/M
3300019377|Ga0190264_12093527Not Available523Open in IMG/M
3300027277|Ga0209846_1004410Not Available2459Open in IMG/M
3300027718|Ga0209795_10132037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300027809|Ga0209574_10123698All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300028712|Ga0307285_10012970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1824Open in IMG/M
3300028717|Ga0307298_10244043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300028719|Ga0307301_10153637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae741Open in IMG/M
3300028721|Ga0307315_10273142Not Available533Open in IMG/M
3300028771|Ga0307320_10086525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1182Open in IMG/M
3300028771|Ga0307320_10470606All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300028778|Ga0307288_10029451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1806Open in IMG/M
3300028793|Ga0307299_10156782Not Available857Open in IMG/M
3300028793|Ga0307299_10251926All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300028807|Ga0307305_10305607All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300028811|Ga0307292_10027617Not Available2037Open in IMG/M
3300028811|Ga0307292_10060011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300028814|Ga0307302_10576991Not Available559Open in IMG/M
3300028814|Ga0307302_10642685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300028819|Ga0307296_10212567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300028878|Ga0307278_10001284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12521Open in IMG/M
3300028878|Ga0307278_10360344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300028880|Ga0307300_10040794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1292Open in IMG/M
3300028880|Ga0307300_10293733Not Available549Open in IMG/M
3300028881|Ga0307277_10561712All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300028884|Ga0307308_10168624Not Available1049Open in IMG/M
3300030496|Ga0268240_10135202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300030499|Ga0268259_10027022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300031548|Ga0307408_100261945All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300031731|Ga0307405_10033470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3049Open in IMG/M
3300031852|Ga0307410_10102297All Organisms → cellular organisms → Bacteria2055Open in IMG/M
3300031901|Ga0307406_11023703Not Available709Open in IMG/M
3300031901|Ga0307406_11128695Not Available678Open in IMG/M
3300031901|Ga0307406_12072553All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031903|Ga0307407_10858427Not Available694Open in IMG/M
3300031911|Ga0307412_10410636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1105Open in IMG/M
3300031911|Ga0307412_11186644Not Available683Open in IMG/M
3300031911|Ga0307412_12038262Not Available532Open in IMG/M
3300031995|Ga0307409_100972973Not Available866Open in IMG/M
3300032002|Ga0307416_100009005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6494Open in IMG/M
3300032002|Ga0307416_101781677Not Available720Open in IMG/M
3300032004|Ga0307414_10079179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2398Open in IMG/M
3300032005|Ga0307411_10164021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1668Open in IMG/M
3300032126|Ga0307415_100062552All Organisms → cellular organisms → Bacteria2582Open in IMG/M
3300032126|Ga0307415_100232149All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300032126|Ga0307415_102151905All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032159|Ga0268251_10077575All Organisms → cellular organisms → Bacteria → Terrabacteria group1144Open in IMG/M
3300033550|Ga0247829_11272102All Organisms → cellular organisms → Bacteria → Terrabacteria group609Open in IMG/M
3300033551|Ga0247830_11089096Not Available638Open in IMG/M
3300034172|Ga0334913_043811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ferrugineus955Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil17.43%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere16.51%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.75%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.75%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere2.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.83%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.83%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.92%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000754Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TBEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_096690102124908045SoilEMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS
KansclcFeb2_151821902124908045SoilLLATLQRLPKDLEVLAFEAGCEEYCEREVDEVEWDDEAAE
JGI11851J11668_100311113300000754SoilMTVRDLLTALQALPRDAELLAFEAGCEDYCEREVDEVEWQGVRVY
JGI10213J12805_1029663813300000858SoilMTVREFLAELQRLPRDAEVLAFEAGCEDYCEREIDDYLTC*
JGI10216J12902_10040870213300000956SoilMTVRDLLTMLQRLPRDAELLAFDAGWEDYCEREMDDYLAS*
JGI10216J12902_10295085153300000956SoilMTLREALAELQRLPRNAELLAFEPGYEEYCEREVDGYLAS*
JGI10216J12902_10433466723300000956SoilMTVREMLAELQRLLRDAELLAFEAGCEDYCERELD
F14TB_10032632023300001431SoilMLTALQTLLDAELLAFEAGEDYGEREVDEVEWQGGRVY
JGI25407J50210_1000855423300003373Tabebuia Heterophylla RhizosphereMTVRDLLTALQRLPRDVGMLAMKAGCEHYCEQEVDYVEL*
JGI25407J50210_1003482933300003373Tabebuia Heterophylla RhizosphereMTVREVLAELQHLPRDAEVLAFEAGCEEFCEREVDEVEVQGGRV
Ga0058697_1004729723300005562AgaveFPQGASSLQHLPRDLEVLAFEAGCQDYCEREVDEVE*
Ga0058697_1024052713300005562AgaveMTVRDLLTELQHLPRDLEVLAFEAGCEDYCEREVDELELQGGR
Ga0058697_1039864523300005562AgaveMTVRDMLTALQALPRNAELLAFEAGCEDYCEREVDEVEW
Ga0068861_10074649933300005719Switchgrass RhizosphereMTVREMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRV
Ga0081538_1000315163300005981Tabebuia Heterophylla RhizosphereMTVKDMLIALQALPRHAELLAFEAGCEDYCEREVDDYLAS*
Ga0082029_116874123300006169Termite NestMLAVLQRFLGGAELLAFEAGCKDYCEREVDEVEWQGGPVYLSRR*
Ga0111538_1055172813300009156Populus RhizosphereMTVREFLAELQHLPRDAEVLAFEAGCKEYCEREIDDCLAF*
Ga0126307_1021744023300009789Serpentine SoilMLTALQTLPRNAELLAFKAGCYHSEDYREREVDDYLAS*
Ga0126307_1100326833300009789Serpentine SoilMTVRDLLATLQRLPKDAELLAFEAGCEDYCEREVDEVEWQDGRV*
Ga0105088_103628523300009810Groundwater SandMTVRDMLTALQMLPRDAELLAFEAGCEDYCEREVDEVEWQG
Ga0126313_10003680123300009840Serpentine SoilMTVRELLAELQHLPRDLEVLAFEAGCEEYCEREVDDYLAC*
Ga0126313_1059876413300009840Serpentine SoilMTVRELLTELQHLPRDLEVLVFEAGCEDYCEREVDE
Ga0126313_1116735723300009840Serpentine SoilMTVGELVVRLQRLPREAELLAMEPGCEEYCEREVDDYLAF*
Ga0126313_1139315523300009840Serpentine SoilMLTALQRLPRDAEVLAMEAGCDQYCEIELDDYLAF*
Ga0105074_102092533300010029Groundwater SandLLTALQVLPRDAELLAFAAGCEDYCERDVDEVEWQGGRVELHL
Ga0126305_1011362913300010036Serpentine SoilMTVREMLTALQMLPRDAELLAFEAGCEDYCEREIDDYLAS*
Ga0126304_1042906813300010037Serpentine SoilRYAGWMTVREMLTALQMLPRDAEVLAFEAGCEDYCEREVDDYLAS*
Ga0126315_1024603823300010038Serpentine SoilMLTALQTLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVFLHL
Ga0126315_1047723823300010038Serpentine SoilLAELQHLPRDLEVLAFEAGCEDYCEREVDDYLAS*
Ga0126315_1108408013300010038Serpentine SoilMIVRDLLTELQHLPRDLEILAFEAGCEAYCEREVDE
Ga0126312_1019709813300010041Serpentine SoilMLTALQNAPRDAELLAFEAGCEDYCEREVDEVEWQGDR
Ga0126312_1043178013300010041Serpentine SoilDLLATLQRLPKDAELLAFEAGCEAYCEREVDDYLAC*
Ga0126312_1134744813300010041Serpentine SoilMTVREFLTELQRLPRDAEVLAFEAGCEDYCEREVDDYLAS*
Ga0126311_1012037323300010045Serpentine SoilMLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS*
Ga0126311_1040205823300010045Serpentine SoilMTVRDLLTVLRTFPGDAELLAFEAGCEDYCEREVDEME*
Ga0126321_127651513300010145SoilLLANLQRLPRHLEVLAFEAGCDDYCEREVDDYLAS*
Ga0126321_135268923300010145SoilLAELQRLLRDAEVLAFEAGCEEYCEREVDDYLAS*
Ga0126321_146214513300010145SoilMLTALQTLPRDAELLAFEADCEDYCEREVDEIEW*
Ga0126306_1013885913300010166Serpentine SoilQLPLGMTVRRMLTRLQHLPQDTEVLAFEPGCEEYCEREVDDYLAS*
Ga0126306_1094934513300010166Serpentine SoilMTVREMLAELQYLLRDAELLAFEAGCEDYCERELDDYLAS*
Ga0126306_1095525523300010166Serpentine SoilMTVREMLLALQTLPRDAELLAFEAGCEDYCEREVDEVEW
Ga0058701_1055493213300010395AgaveGRLAGYARHMTVGDMLATLQRLPRDAELLAFEPGCQDDGEREVDELELQGDRV*
Ga0138514_10010175713300011003SoilMLTALQTLPRDAELLAFEAGCEDYCERELDEVEWQGGRVYLH
Ga0120192_1000013213300012021TerrestrialMLTALQLLPRDAELLAFEAGGEDYCEREVDEVEWQGGRGDLHPGV
Ga0120192_1003197523300012021TerrestrialMTVREFLTELQRLPRDAEGLAFEAGCEEYCEREIDDNLAS*
Ga0137374_1084360813300012204Vadose Zone SoilRMMVRDLVAALQRLPKDAELLAFEPGCEDYCEREIDDCLAEASGT*
Ga0137377_1048690023300012211Vadose Zone SoilMTVHELTSRLLRLPRDAEVLAFEPGCEQYFEREVDDV
Ga0137369_1022934423300012355Vadose Zone SoilMTVRELLAELQHLPRDLEVLAFEAGCEDYCERELDELDL
Ga0137375_1144640523300012360Vadose Zone SoilMTVREFLAELQRLPRDAEVLAFEAGCEDYCEREIDEVEVQGG
Ga0162652_10005303513300012941SoilMLTALQTLPRDAELLAFEAGCENYCEREVDEVEWKGGRADSP*
Ga0163162_1177897613300013306Switchgrass RhizosphereMLTALQAFPRDAELLAFEAGCEDYREREVDVYLAS*
Ga0182000_1000118863300014487SoilMTVRDLLTELQHLPRDLEVLAFEAGCEDYCEREVDELEL
Ga0182000_1006792213300014487SoilMLTVLQTLPRDAELLAFEAGCEDYCEREVDELELQGGR
Ga0182000_1037553633300014487SoilMTVRDLLATLQRLPKDAELLAFEAGCEDYCGREVDEV
Ga0190266_1057500823300017965SoilMTVRDLLTALQALPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0184620_1003193613300018051Groundwater SedimentEMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGSRV
Ga0184632_1021575113300018075Groundwater SedimentMTVQDMLTALQRLPRDAEVLAFEAGCEEYCEREVDEV
Ga0190265_1104404233300018422SoilMTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDDLEF
Ga0190265_1157117313300018422SoilMTVRELLAELQHLPRDLEVLAFEVGCEDYCVPCRTR
Ga0190268_1206411913300018466SoilGRMTVRDMLIRLQTLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0190264_1209352713300019377SoilMTGRELLAELQHLPRDLEVLAFEAGCEDYCEREIDELELQG
Ga0209846_100441043300027277Groundwater SandMTVGELLVRMQRLPRDAELLAMEPGCEEYCEREVDEVEWQVFSA
Ga0209795_1013203713300027718AgaveMLTALQTLPRDAELLASEADCEDYREREVDEIEWQGDWVYLHLGC
Ga0209574_1012369813300027809AgaveMLTALQRLPRDAEVLGMEAGCEPYCEIELDDVKLQGDRVYLHPRGSA
Ga0307285_1001297053300028712SoilMLTALQTLPRDAELLAFEGGCENYCEREVDEVEWQG
Ga0307298_1024404323300028717SoilMTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDDYLACQ
Ga0307301_1015363723300028719SoilRDMLTALQTLPRDAELLAFEDGSEDYCEREVDDHLGPSEMAAP
Ga0307315_1027314213300028721SoilMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGG
Ga0307320_1008652513300028771SoilMTARDMLTALQTLPRDAELLAFEDGSEDYCEREVDDHLGPSEMAAP
Ga0307320_1047060623300028771SoilHMTVRDMLTALQALLRDAELLAFEAGCEDYCEREVDDYQAF
Ga0307288_1002945123300028778SoilMLTALQTLPRDAELLAFEAGCKDYCEREVDEVEWQGDRV
Ga0307299_1015678223300028793SoilMTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDELEF
Ga0307299_1025192613300028793SoilMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQ
Ga0307305_1030560713300028807SoilMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVYL
Ga0307292_1002761713300028811SoilMTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0307292_1006001133300028811SoilMTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDEV
Ga0307302_1057699113300028814SoilMTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDELELQGGRV
Ga0307302_1064268523300028814SoilMTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDEVEWQGGR
Ga0307296_1021256723300028819SoilMTVQDLLTALQRLPRDAEPLAFEPGCEEYCEREIDDYLAC
Ga0307278_1000128453300028878SoilMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0307278_1036034413300028878SoilMTVRDMLTALQVLPRDAELLAFQAGCEDYCEREVDDY
Ga0307300_1004079433300028880SoilMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVYLHLG
Ga0307300_1029373323300028880SoilASSPGGITVRELLATLQQLPRDTEVLVFEPGCEEYCECEVDEVEL
Ga0307277_1056171223300028881SoilMTVPDLLATLQRLPKDIEVLAFEAACEDYCEDYCEREVDEI
Ga0307308_1016862423300028884SoilMTVRELLAALQRLLRDGEVVAFEPGCEEYCEREVDDYLAS
Ga0268240_1013520213300030496SoilMTVRDMLTALQTLPRDAELLAFEAGCEDYCEREIHEVEWQRGRVY
Ga0268259_1002702213300030499AgaveMTVRELLAQLQHLPRDLEVLAFEAGCEDYCEREVDE
Ga0307408_10026194523300031548RhizosphereMTVRDLLTGLQHLPRDLEVLTFEAGCEDYCEREVDDYLAS
Ga0307405_1003347043300031731RhizosphereMTVRELLAELQHLPRDLEVLAFEAGCEEYCEREVDDYLAC
Ga0307410_1010229733300031852RhizosphereVRDLLTGLQHLPRDLEVLTFEAGCEDYCEREVDDYLAS
Ga0307406_1102370313300031901RhizosphereMTVREFLAGLQHLPRDAEVLAFEAGCEEYCEREVDEVEVQGG
Ga0307406_1112869523300031901RhizosphereMTVREMLLALQTLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0307406_1207255323300031901RhizosphereMTVRDLLTELQHLPRDLEVLTFEAGCEDHCEREVDELRLQD
Ga0307407_1085842723300031903RhizosphereMLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0307412_1041063623300031911RhizosphereMTVREFLAELQHLPRDAEVLAFEAGCEDYCEREIDEV
Ga0307412_1118664413300031911RhizosphereMTVRDMLTALQTLPREAELLAFEAGCEDYCEREVDE
Ga0307412_1203826213300031911RhizosphereMTVREFLAELQHLPRDAEVLAFEAGCEDYCEREIDEVE
Ga0307409_10097297313300031995RhizosphereMTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDEVQWQ
Ga0307416_10000900593300032002RhizosphereMTVRELLAQLQHLPRDLEVLAFEAGCEDYCEREVDELEL
Ga0307416_10178167713300032002RhizosphereMTVRELLAELQLLPRDLEVLAFEAGCEDYCEREVDDYLVS
Ga0307414_1007917923300032004RhizosphereMTVRDLLTGLQHLPRDLEVLTFEAGCKDYCEREVDDYLAS
Ga0307411_1016402123300032005RhizosphereMTVREMLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS
Ga0307415_10006255233300032126RhizosphereMTVKEFLAQLQHLPRDAEVLAFEAGCEEYCEREIDDYLAS
Ga0307415_10023214913300032126RhizosphereMTVRDLLATLQRLPKDAELLAFEAGCEDYCEREVDDYLAS
Ga0307415_10215190513300032126RhizosphereMLTALQTLPRDAELLAFEAGCEDYCEREVDEVEWQ
Ga0268251_1007757533300032159AgaveMHDSRDQVAQLQHLPRDLEVLAFEADCEDYCEREADELALQGGRVYLH
Ga0247829_1127210223300033550SoilTLPRDAELLALEAGCENYCEREVDEVEWKGGRADSPRG
Ga0247830_1108909613300033551SoilMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVY
Ga0334913_043811_789_9113300034172Sub-Biocrust SoilMTVRELLAELQQLPRDAELLAFEPGCQDYCEREVDDYLVC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.