


| Basic Information | |
|---|---|
| Family ID | F088773 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKKVIAVVFVALLSTGVMAQVKCQPDGRGGMCCWDVGTQGPFKPIGC |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 81.48 % |
| % of genes near scaffold ends (potentially truncated) | 28.44 % |
| % of genes from short scaffolds (< 2000 bps) | 68.81 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (41.284 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (29.358 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.220 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.881 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.67% β-sheet: 13.33% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 20.18 |
| PF05866 | RusA | 11.01 |
| PF11753 | DUF3310 | 11.01 |
| PF12705 | PDDEXK_1 | 7.34 |
| PF01612 | DNA_pol_A_exo1 | 4.59 |
| PF03837 | RecT | 2.75 |
| PF11351 | GTA_holin_3TM | 1.83 |
| PF13872 | AAA_34 | 1.83 |
| PF09954 | DUF2188 | 1.83 |
| PF14090 | HTH_39 | 0.92 |
| PF13203 | DUF2201_N | 0.92 |
| PF13578 | Methyltransf_24 | 0.92 |
| PF01870 | Hjc | 0.92 |
| PF05050 | Methyltransf_21 | 0.92 |
| PF00271 | Helicase_C | 0.92 |
| PF02195 | ParBc | 0.92 |
| PF16509 | KORA | 0.92 |
| PF06048 | DUF927 | 0.92 |
| PF00239 | Resolvase | 0.92 |
| PF11775 | CobT_C | 0.92 |
| PF04221 | RelB | 0.92 |
| PF08291 | Peptidase_M15_3 | 0.92 |
| PF01507 | PAPS_reduct | 0.92 |
| PF00176 | SNF2-rel_dom | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 11.01 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 2.75 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.92 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.92 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.92 |
| COG3077 | Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module | Defense mechanisms [V] | 0.92 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.48 % |
| Unclassified | root | N/A | 27.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10127224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WWE3 → candidate division WWE3 bacterium CG10_big_fil_rev_8_21_14_0_10_32_10 | 507 | Open in IMG/M |
| 3300002197|metazooDRAFT_1227224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 736 | Open in IMG/M |
| 3300002307|JGI24890J29729_1001252 | All Organisms → cellular organisms → Bacteria | 11935 | Open in IMG/M |
| 3300002408|B570J29032_109766079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300002408|B570J29032_109846843 | Not Available | 1623 | Open in IMG/M |
| 3300002471|metazooDRAFT_1461041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300002471|metazooDRAFT_1488183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300002835|B570J40625_100860584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 789 | Open in IMG/M |
| 3300002835|B570J40625_101295405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300004240|Ga0007787_10570330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300005527|Ga0068876_10003826 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 10679 | Open in IMG/M |
| 3300005527|Ga0068876_10453599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300005662|Ga0078894_10236817 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300005662|Ga0078894_10659556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300005805|Ga0079957_1054312 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300006641|Ga0075471_10111230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
| 3300006805|Ga0075464_10406852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300006805|Ga0075464_10437791 | Not Available | 797 | Open in IMG/M |
| 3300006917|Ga0075472_10178603 | Not Available | 1043 | Open in IMG/M |
| 3300008072|Ga0110929_1039539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1912 | Open in IMG/M |
| 3300008108|Ga0114341_10111652 | Not Available | 1644 | Open in IMG/M |
| 3300008108|Ga0114341_10508243 | Not Available | 543 | Open in IMG/M |
| 3300008448|Ga0114876_1001088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20528 | Open in IMG/M |
| 3300008450|Ga0114880_1005482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6678 | Open in IMG/M |
| 3300009037|Ga0105093_10195134 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300009037|Ga0105093_10589710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300009081|Ga0105098_10495290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300009081|Ga0105098_10631277 | Not Available | 561 | Open in IMG/M |
| 3300009082|Ga0105099_10293005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300009159|Ga0114978_10223697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
| 3300009165|Ga0105102_10667845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300009183|Ga0114974_10000299 | Not Available | 42111 | Open in IMG/M |
| 3300010354|Ga0129333_10079048 | All Organisms → Viruses → Predicted Viral | 3052 | Open in IMG/M |
| 3300010354|Ga0129333_10307801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1417 | Open in IMG/M |
| 3300010354|Ga0129333_10593794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300010354|Ga0129333_10698930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| 3300010354|Ga0129333_11431219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300010354|Ga0129333_11711827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300010885|Ga0133913_10200596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5318 | Open in IMG/M |
| 3300010885|Ga0133913_12448368 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300010885|Ga0133913_12756112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
| 3300011113|Ga0151517_1226 | Not Available | 22678 | Open in IMG/M |
| 3300011113|Ga0151517_1730 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 10850 | Open in IMG/M |
| 3300011339|Ga0153700_11173 | Not Available | 11575 | Open in IMG/M |
| 3300013004|Ga0164293_10000520 | Not Available | 30759 | Open in IMG/M |
| 3300013004|Ga0164293_10010247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7872 | Open in IMG/M |
| 3300013004|Ga0164293_10024967 | All Organisms → cellular organisms → Bacteria | 4984 | Open in IMG/M |
| 3300013005|Ga0164292_10047458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3395 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10411302 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10065428 | All Organisms → Viruses → Predicted Viral | 3336 | Open in IMG/M |
| 3300014819|Ga0119954_1018307 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300015050|Ga0181338_1034206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300017747|Ga0181352_1135201 | Not Available | 659 | Open in IMG/M |
| 3300017754|Ga0181344_1009952 | All Organisms → Viruses → Predicted Viral | 3067 | Open in IMG/M |
| 3300017754|Ga0181344_1074173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300017754|Ga0181344_1154293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300017761|Ga0181356_1036968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1729 | Open in IMG/M |
| 3300017785|Ga0181355_1171110 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300019784|Ga0181359_1040845 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300020183|Ga0194115_10002007 | Not Available | 24888 | Open in IMG/M |
| 3300020554|Ga0208599_1052525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300022179|Ga0181353_1094428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 742 | Open in IMG/M |
| 3300022179|Ga0181353_1158617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300022752|Ga0214917_10015342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6659 | Open in IMG/M |
| 3300022752|Ga0214917_10042192 | All Organisms → Viruses → Predicted Viral | 3212 | Open in IMG/M |
| 3300023174|Ga0214921_10188421 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300023174|Ga0214921_10218839 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300023184|Ga0214919_10376779 | Not Available | 933 | Open in IMG/M |
| 3300024289|Ga0255147_1099234 | Not Available | 536 | Open in IMG/M |
| 3300024506|Ga0255168_1062705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300027693|Ga0209704_1252861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300027734|Ga0209087_1136004 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300027763|Ga0209088_10190614 | Not Available | 882 | Open in IMG/M |
| 3300027782|Ga0209500_10183481 | Not Available | 957 | Open in IMG/M |
| 3300027792|Ga0209287_10439315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027793|Ga0209972_10427722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300027808|Ga0209354_10216387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Psychrobacter → unclassified Psychrobacter → Psychrobacter sp. C 20.9 | 774 | Open in IMG/M |
| 3300027816|Ga0209990_10005225 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 8913 | Open in IMG/M |
| 3300027900|Ga0209253_10333698 | Not Available | 1168 | Open in IMG/M |
| 3300028025|Ga0247723_1012466 | Not Available | 3198 | Open in IMG/M |
| 3300028025|Ga0247723_1107426 | Not Available | 696 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1210446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 726 | Open in IMG/M |
| 3300031758|Ga0315907_10007375 | Not Available | 11470 | Open in IMG/M |
| 3300031787|Ga0315900_10015079 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 9313 | Open in IMG/M |
| 3300031857|Ga0315909_10338424 | Not Available | 1105 | Open in IMG/M |
| 3300031857|Ga0315909_10350619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1079 | Open in IMG/M |
| 3300031963|Ga0315901_11213841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300032050|Ga0315906_10262681 | Not Available | 1578 | Open in IMG/M |
| 3300033980|Ga0334981_0013636 | All Organisms → Viruses → Predicted Viral | 4569 | Open in IMG/M |
| 3300033993|Ga0334994_0275703 | Not Available | 867 | Open in IMG/M |
| 3300033993|Ga0334994_0334967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300033996|Ga0334979_0000196 | Not Available | 48301 | Open in IMG/M |
| 3300033996|Ga0334979_0000943 | Not Available | 21674 | Open in IMG/M |
| 3300033996|Ga0334979_0141282 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300034061|Ga0334987_0002560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17658 | Open in IMG/M |
| 3300034062|Ga0334995_0016315 | Not Available | 6754 | Open in IMG/M |
| 3300034062|Ga0334995_0194260 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300034062|Ga0334995_0335868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium litorale | 974 | Open in IMG/M |
| 3300034101|Ga0335027_0308489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300034101|Ga0335027_0350279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300034101|Ga0335027_0646378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300034106|Ga0335036_0044938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3404 | Open in IMG/M |
| 3300034106|Ga0335036_0050617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3179 | Open in IMG/M |
| 3300034111|Ga0335063_0002345 | Not Available | 11903 | Open in IMG/M |
| 3300034111|Ga0335063_0505522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300034112|Ga0335066_0594865 | Not Available | 573 | Open in IMG/M |
| 3300034116|Ga0335068_0008747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6492 | Open in IMG/M |
| 3300034116|Ga0335068_0335025 | Not Available | 742 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 29.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.34% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.50% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.75% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.75% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.83% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.83% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.92% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.92% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002197 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_101272242 | 3300001851 | Marine Plankton | MKKLVAVVLLSLSLSAIAQVKCESDGRGGMCCWDISKDGPWKPIGC* |
| metazooDRAFT_12272242 | 3300002197 | Lake | MKKVIAVALLAMMSLSVSAQVKCVPDGKGGMCCWDVGQQGPFRPIGC* |
| JGI24890J29729_10012525 | 3300002307 | Lentic | MKKLIALAFIALLSTNVMSAVKCAPDGRGGVCCWDTATDGIFKPVVC* |
| B570J29032_1097660794 | 3300002408 | Freshwater | MKAIIIAVLTIGFIGSVSAQVKCQPDGRGGMCCWDVGTQGPFKPLGC* |
| B570J29032_1098468432 | 3300002408 | Freshwater | MKKAIALIFVALLSTGVMAQTKCVPDGKGGMCCWDVGTQGPFKPIGC* |
| metazooDRAFT_14610412 | 3300002471 | Lake | MKKLIAVVFIALMSTGVMAQVKCQPDGRGGMCCWDISKDGPWKPIGC* |
| metazooDRAFT_14881832 | 3300002471 | Lake | MKKAIAVIFVALLSTGVMAQTKCVPDGKGGMCCWDVGSQGPFKPIGC* |
| B570J40625_1008605842 | 3300002835 | Freshwater | MKKLIAVIFIALMSTGVMAQVKCESDGRGGMCCWDFDKQGPWKPIGC* |
| B570J40625_1012954052 | 3300002835 | Freshwater | MKKLIAVAFIAMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| JGI26470J50227_10160064 | 3300003375 | Freshwater | MKKMIAVALLALTCTSIYAATKCVPDGRGGMCCWDTETDGIYKPISC* |
| Ga0007787_105703301 | 3300004240 | Freshwater Lake | MKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0068876_1000382619 | 3300005527 | Freshwater Lake | MKKVIVALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC* |
| Ga0068876_104535991 | 3300005527 | Freshwater Lake | MKKLIAVAFIALLSTGAMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0078894_102368172 | 3300005662 | Freshwater Lake | MKKAIAFVFVALLSTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC* |
| Ga0078894_106595561 | 3300005662 | Freshwater Lake | MKKAIVAVFITLLTTSVMAQVKCESDGRGGMCCWDTKVNGPWKP |
| Ga0079957_10543122 | 3300005805 | Lake | MKKVIAVVFVALLSTGVMAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0075471_101112302 | 3300006641 | Aqueous | MKKAIAIVLLSMMSLSVSAQVKCVPDGKGGMCCWDVGQQGPFRPIGC* |
| Ga0075464_104068522 | 3300006805 | Aqueous | MKKLIAVAFIALMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0075464_104377913 | 3300006805 | Aqueous | MKKAIAIVLLSMMSLGVSAQVKCVPDGKGGMCCWDVGQQGPFRPIGC* |
| Ga0075472_101786033 | 3300006917 | Aqueous | MKKAIAIILLSMMSLSVSAQVKCVPDGKGGICCWDVGQQGPFRPIGC* |
| Ga0110929_10395393 | 3300008072 | Water Bodies | MKKLLAVVLLAMMSYSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0114341_101116521 | 3300008108 | Freshwater, Plankton | KKVIVALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC* |
| Ga0114341_105082431 | 3300008108 | Freshwater, Plankton | IQMYPFKEITMKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0114876_100108812 | 3300008448 | Freshwater Lake | MYPFKEITMKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0114880_10054826 | 3300008450 | Freshwater Lake | MKKLIAVAFIALLSTGAMAQVKCESDGRGGMCCWDTKVNGPWKP |
| Ga0105093_101951342 | 3300009037 | Freshwater Sediment | MKKLIAIAFIALLSTSVYSATKCVSDGRGGVCCWDTEKD |
| Ga0105093_105897102 | 3300009037 | Freshwater Sediment | MKMKKAIVVLFVAMLSTSAMAVTKCESDGRGGMCCWDVNKD |
| Ga0105098_104952902 | 3300009081 | Freshwater Sediment | MKKLVAVAFIALLSTGVMAQVKCVPDGRGGMCCWDINKDGPWKPIGC* |
| Ga0105098_106312772 | 3300009081 | Freshwater Sediment | MYPFKEITMKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDAGTQGPFKPIIC* |
| Ga0105099_102930052 | 3300009082 | Freshwater Sediment | MKKLIAIAFIALLSTSVYSATKCVPDGRGGMCCWDTDRDGPWKPIGC* |
| Ga0114978_102236972 | 3300009159 | Freshwater Lake | MYPFKEITMKKAIAIVLLSMISLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0105102_106678452 | 3300009165 | Freshwater Sediment | MKKVIAVLFVAMLSTGVMAQVKCVPDGRGGMCCWDVQTQGPFKPISC* |
| Ga0114974_1000029924 | 3300009183 | Freshwater Lake | MKKVIAIICLTLATTSVFAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0129333_100790482 | 3300010354 | Freshwater To Marine Saline Gradient | MYPFKEITMKKAIVIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0129333_103078012 | 3300010354 | Freshwater To Marine Saline Gradient | MKKAIVAVFITLLTTSVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0129333_105937941 | 3300010354 | Freshwater To Marine Saline Gradient | GAVMKKAIAVVFVALLSTGVMAQTKCVPDGKGGMCCWDVGSQGPFKPIGC* |
| Ga0129333_106989302 | 3300010354 | Freshwater To Marine Saline Gradient | AMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0129333_114312193 | 3300010354 | Freshwater To Marine Saline Gradient | MKKAIVAVCITLLTTGVMAQVKCQPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0129333_117118272 | 3300010354 | Freshwater To Marine Saline Gradient | MKKLIAVAFIAMMSTGVMAQVKCQPDGRGGMCCWDISKDGPWKPIGC* |
| Ga0133913_1020059617 | 3300010885 | Freshwater Lake | MKKAIVAVFITLLTTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC* |
| Ga0133913_124483682 | 3300010885 | Freshwater Lake | MKKLIAVAFIALMSTGVMAQTKCVPDGKGGMCCWDVGTQGPWKPLGC* |
| Ga0133913_127561121 | 3300010885 | Freshwater Lake | MVKYPFKEMSMKKAIAIVLLSMMSLGVSAQVKCVPDGKGGMCCWDVGQQGPFRPIGC* |
| Ga0151517_122617 | 3300011113 | Freshwater | MKKAIVAVFISLLTTGVMAQVKCESDGRGGMCCWDVGKQGPWKPIGC* |
| Ga0151517_173012 | 3300011113 | Freshwater | MKKLIAFAFAAVLSSSVFAQVKCESDGRGGMCCWDTKVYGPWKPISC* |
| Ga0153700_1117316 | 3300011339 | Freshwater | MKKAIVAVFITLLTTGVMAQVKCESDGRGGMCCWDVGKQGPWKPIGC* |
| Ga0164293_1000052015 | 3300013004 | Freshwater | MKKAIVVICVTLLTTGVMAQTKCVPDGRGGMCCWDVGTQGPFKPIGC* |
| Ga0164293_100102472 | 3300013004 | Freshwater | MKKLIAVAIVALISTGVYAQTKCVPDGRGGMCCWDTRTQGPFKPIGC* |
| Ga0164293_100249675 | 3300013004 | Freshwater | MKKLIAVAFIALLSTGVMAQVKCVPDGRGGMCCWDINKDGPWKPIGC* |
| Ga0164292_100474584 | 3300013005 | Freshwater | MKKIIAVLFIAMMSTSVMAQVKCESDGRGGMCCWDIGKQGPWRPIGC* |
| (restricted) Ga0172367_104113022 | 3300013126 | Freshwater | MKKAIVAVFITFLTTGAMAQVKCQPDGRGGMCCWDIGTEGPFKPIGC* |
| (restricted) Ga0172372_100654288 | 3300013132 | Freshwater | MKKLVAIALLAMLSFSASAQVKCQPDGSGGMCCWDVGTQGPFKPISC* |
| Ga0119954_10183072 | 3300014819 | Freshwater | MKKLIAFVFAAVLSSSVFAQVKCESDGRGGMCCWDTKVYGPWKPITC* |
| Ga0181338_10342061 | 3300015050 | Freshwater Lake | MYLFKEITMKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKP |
| Ga0181352_11352011 | 3300017747 | Freshwater Lake | KSMKKAIAIVFVALLSTGVMAQMKCVPDGRGGMCCWDVGTQGPFKPIGC |
| Ga0181344_10099522 | 3300017754 | Freshwater Lake | MKKLIAVAIVALMSTGVYAQTKCVPDGRGGMCCWDTRTQGPFKPIGC |
| Ga0181344_10741732 | 3300017754 | Freshwater Lake | MKKLIAVAFIALMSTGVMAQTKCVPDGKGGMCCWDVGTQGPWKPLGC |
| Ga0181344_11542931 | 3300017754 | Freshwater Lake | MKKLIAVAFIALMSTGVMAQVKCESDGRGGMCCWDTKVNGP |
| Ga0181356_10369682 | 3300017761 | Freshwater Lake | MKKLIAVAFIAMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKLIGC |
| Ga0181355_11711102 | 3300017785 | Freshwater Lake | MKKAIAFVFVALLSTGVMAQVKCESDGRGGMCCWDTRVNGPFRPIGC |
| Ga0181359_10408452 | 3300019784 | Freshwater Lake | MKKLIAVAFIAMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0194115_1000200716 | 3300020183 | Freshwater Lake | MKKAIAVVFVALLSTGVMAQTKCVPDGKGGMCCWDVGSQGPFKPIGC |
| Ga0208599_10525252 | 3300020554 | Freshwater | MKKAIAVVFVALLSTGVMAQVKCQPDGRGGMCCWDVGTQGPFKPLGC |
| Ga0181353_10944283 | 3300022179 | Freshwater Lake | MKKLIAVAFIALMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0181353_11586172 | 3300022179 | Freshwater Lake | MKKAIAFVFVALLSTGAMAQVKCESDGRGGMCCWDTKVNGPFRPFGC |
| Ga0214917_1001534213 | 3300022752 | Freshwater | MKKAIAIVLLSMMSLSVSAQVKCVPDGKGGMCCWDVGTQGPFRPIGC |
| Ga0214917_100421922 | 3300022752 | Freshwater | MKKLIAFAFAAMLSSSVFAQVKCESDGRGGMCCWDTKQYGPFKPLVC |
| Ga0214921_101884212 | 3300023174 | Freshwater | MKKLIAFVFAAVLSSSVFAQVKCESDGRGGMCCWDTKVYGPWKPITC |
| Ga0214921_102188394 | 3300023174 | Freshwater | MKKLIAFAFAAMLSSSVFAQVKCESDGRGGMCCWDTKVYGPWKPISC |
| Ga0214919_103767791 | 3300023184 | Freshwater | KEMSMKKAIAIVLLSMMSLSVSAQVKCVPDGKGGMCCWDVGQQGPFRPIGC |
| Ga0255147_10992341 | 3300024289 | Freshwater | MKKAIAVVFVALLSTGVMAQTKCVPDGKGGMCCWDVGSQGP |
| Ga0255168_10627051 | 3300024506 | Freshwater | FVALLSTGVMAQTKCVPDGKGGMCCWDVGSQGPFKPIGC |
| Ga0209704_12528611 | 3300027693 | Freshwater Sediment | MKKVIAVLFVAMLSTGVMAQVKCVPDGRGGMCCWDVQTQ |
| Ga0209087_11360044 | 3300027734 | Freshwater Lake | MKKVIAIICLTLATTSVFAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0209088_101906143 | 3300027763 | Freshwater Lake | MKKAIAIVLLSMISLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC |
| Ga0209500_101834811 | 3300027782 | Freshwater Lake | MLKIQMYPFKEITMKKAIAIVLLSMISLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC |
| Ga0209287_104393152 | 3300027792 | Freshwater Sediment | MKKLIAVAIVALISTGVYAQTKCVPDGRGGMCCWDVGTQGPW |
| Ga0209972_104277221 | 3300027793 | Freshwater Lake | MKKLIAVAFIALLSTGAMAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0209354_102163872 | 3300027808 | Freshwater Lake | MKKLIAVIFIALMSIGVMAQVKCESDGRGGMCCWDFDKQGPWKPI |
| Ga0209990_1000522518 | 3300027816 | Freshwater Lake | MKKVIVALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNG |
| Ga0209253_103336983 | 3300027900 | Freshwater Lake Sediment | MKKVIALVFVAFLSTGVMAQTKCVPDGKGGMCCWDV |
| Ga0247723_10124667 | 3300028025 | Deep Subsurface Sediment | MKKAIALVFVALLSTGAMAQTKCVPDGRGGMCCWDVQTQGPFKPIMC |
| Ga0247723_11074262 | 3300028025 | Deep Subsurface Sediment | MKKLVAVALLAMLSFSVSAQVKCESDGRGGMCCWDTRTQGPFKPFGC |
| (restricted) Ga0247844_12104461 | 3300028571 | Freshwater | LSFSVSAQVKCQPDGRGGMCCWDAGTQGPFEPIIC |
| Ga0315907_100073751 | 3300031758 | Freshwater | VALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC |
| Ga0315900_100150791 | 3300031787 | Freshwater | MKKVIVALFITLLTTGAMAQVKCESDGRGGMCCWDTRV |
| Ga0315909_103384241 | 3300031857 | Freshwater | KVIVALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC |
| Ga0315909_103506194 | 3300031857 | Freshwater | MKKIIAIVCLTLATTSVFAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0315901_112138411 | 3300031963 | Freshwater | MYPFKEITMKKAIAIVLLSMMSLSVSAQVKCQPDGRGGMCCWDVGTQGPFKPIGC |
| Ga0315906_102626811 | 3300032050 | Freshwater | ALFITLLTTGAMAQVKCESDGRGGMCCWDTRVNGPFRPIGC |
| Ga0334981_0013636_454_597 | 3300033980 | Freshwater | MKKIIAVLFIAMMSTSVMAQVKCESDGRGGMCCWDIGKQGPWRPIGC |
| Ga0334994_0275703_395_538 | 3300033993 | Freshwater | MKKAIALIFVALLSTGVMAQTKCVPDGKGGMCCWDVGTQGPFKPIGC |
| Ga0334994_0334967_236_379 | 3300033993 | Freshwater | MKKLIAVIFIALMSTGLMAQVKCESDGRGGMCCWDFDKQGPWKPIGC |
| Ga0334979_0000196_39342_39485 | 3300033996 | Freshwater | MKKLIAVAIVALISTGVYAQTKCVPDGRGGMCCWDVQTQGPFKPIGC |
| Ga0334979_0000943_19758_19901 | 3300033996 | Freshwater | MKKAIVVICVTLLTTGVMAQTKCVPDGRGGMCCWDVGTQGPFKPIGC |
| Ga0334979_0141282_182_325 | 3300033996 | Freshwater | MKKLIAVAFIALLSTGVMAQVKCVPDGRGGMCCWDINKDGPWKPIGC |
| Ga0334987_0002560_16747_16890 | 3300034061 | Freshwater | MKKLIAVAIVALISTGVYAQTKCVPDGRGGMCCWDIKTQGPFKPIGC |
| Ga0334995_0016315_3903_4046 | 3300034062 | Freshwater | MKAIIIAVLTIGFIGSVSAQVKCQPDGRGGMCCWDVGTQGPFKPLGC |
| Ga0334995_0194260_2_139 | 3300034062 | Freshwater | KLIAVIFIALMSTGVMAQVKCESDGRGGMCCWDFDKQGPWKPIGC |
| Ga0334995_0335868_718_861 | 3300034062 | Freshwater | MKKLIAVAFIALMSTGVMAQVKCEPDGRGGMCCWDIRKDGPWKPIGC |
| Ga0335027_0308489_371_514 | 3300034101 | Freshwater | MKKLIAFAFAAVLSSSVFAQVKCESDGRGGMCCWDTKVYGPFKPISC |
| Ga0335027_0350279_61_204 | 3300034101 | Freshwater | MKKLIAVAFVAMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0335027_0646378_3_125 | 3300034101 | Freshwater | MKKAIVAVFITLLTTGVMAQVKCESDGRGGMCCWDVGKQGP |
| Ga0335036_0044938_85_228 | 3300034106 | Freshwater | MKKAIAVLFVAMLSTGVMAQVKCVPDGRGGMCCWDISKDGPFKPIGC |
| Ga0335036_0050617_1_135 | 3300034106 | Freshwater | MKKLIVMAFIALMSTGVMAQVKCVPDGRGGMCCWDIGKDGPWKPI |
| Ga0335063_0002345_7202_7345 | 3300034111 | Freshwater | MKKAIAFVFVAMLSTGVMAQVKCESDGRGGMCCWDTRVNGPWKPIGC |
| Ga0335063_0505522_3_143 | 3300034111 | Freshwater | KKLIAVAFIAMMSTGVMAQVKCESDGRGGMCCWDTKVNGPWKPIGC |
| Ga0335066_0594865_2_118 | 3300034112 | Freshwater | MKKLIAVIFIALMSTGVMAQVKCESDGRGGMCCWDFDKQ |
| Ga0335068_0008747_5654_5797 | 3300034116 | Freshwater | MKKLIAVIFIALMSTGVMAQVKCESDGRGGMCCWDIGKQGPWKPIGC |
| Ga0335068_0335025_2_112 | 3300034116 | Freshwater | LMSTGVMAQVKCESDGRGGMCCWDIGKQGPWKPIGC |
| ⦗Top⦘ |