NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088754

Metagenome / Metatranscriptome Family F088754

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088754
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 56 residues
Representative Sequence SGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST
Number of Associated Samples 98
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.30 %
% of genes near scaffold ends (potentially truncated) 67.89 %
% of genes from short scaffolds (< 2000 bps) 80.73 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.991 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(21.101 % of family members)
Environment Ontology (ENVO) Unclassified
(28.440 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.633 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.33%    β-sheet: 12.66%    Coil/Unstructured: 81.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00171Aldedh 8.26
PF05050Methyltransf_21 7.34
PF01218Coprogen_oxidas 6.42
PF01425Amidase 4.59
PF00248Aldo_ket_red 3.67
PF00149Metallophos 2.75
PF13302Acetyltransf_3 2.75
PF01834XRCC1_N 2.75
PF07992Pyr_redox_2 1.83
PF00106adh_short 0.92
PF05532CsbD 0.92
PF04199Cyclase 0.92
PF01979Amidohydro_1 0.92
PF09903DUF2130 0.92
PF03055RPE65 0.92
PF12651RHH_3 0.92
PF00589Phage_integrase 0.92
PF04140ICMT 0.92
PF09265Cytokin-bind 0.92
PF07995GSDH 0.92
PF13607Succ_CoA_lig 0.92
PF00691OmpA 0.92
PF02133Transp_cyt_pur 0.92
PF10282Lactonase 0.92
PF02574S-methyl_trans 0.92
PF01847VHL 0.92
PF02308MgtC 0.92
PF04366Ysc84 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 8.26
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 8.26
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 8.26
COG0408Coproporphyrinogen-III oxidase HemH, oxygen-dependentCoenzyme transport and metabolism [H] 6.42
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 4.59
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.92
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.92
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 0.92
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.92
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.92
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.92
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.92
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 0.92
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.92
COG3670Carotenoid cleavage dioxygenase or a related enzymeSecondary metabolites biosynthesis, transport and catabolism [Q] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.99 %
UnclassifiedrootN/A11.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002909|JGI25388J43891_1029629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium901Open in IMG/M
3300004092|Ga0062389_103821141All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300004631|Ga0058899_11280154All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005175|Ga0066673_10257972All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1010Open in IMG/M
3300005175|Ga0066673_10704240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300005176|Ga0066679_10518695All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium776Open in IMG/M
3300005181|Ga0066678_10026596All Organisms → cellular organisms → Bacteria3099Open in IMG/M
3300005181|Ga0066678_10708104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium670Open in IMG/M
3300005184|Ga0066671_10316141All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300005363|Ga0008090_14851196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria755Open in IMG/M
3300005552|Ga0066701_10280908All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1031Open in IMG/M
3300005560|Ga0066670_10080893All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1772Open in IMG/M
3300005560|Ga0066670_10589387All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005561|Ga0066699_11174044All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005566|Ga0066693_10014999All Organisms → cellular organisms → Bacteria2261Open in IMG/M
3300005575|Ga0066702_10064975All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2001Open in IMG/M
3300005575|Ga0066702_10980103All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium506Open in IMG/M
3300005586|Ga0066691_10200424All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005994|Ga0066789_10342677Not Available625Open in IMG/M
3300005994|Ga0066789_10453042All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium536Open in IMG/M
3300005995|Ga0066790_10004969All Organisms → cellular organisms → Bacteria → Proteobacteria5898Open in IMG/M
3300006032|Ga0066696_10623515All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300006642|Ga0075521_10236232Not Available872Open in IMG/M
3300006796|Ga0066665_10186818All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300006800|Ga0066660_10249135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1388Open in IMG/M
3300007076|Ga0075435_101960680All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium514Open in IMG/M
3300009012|Ga0066710_101453497All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300009012|Ga0066710_102895756All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium673Open in IMG/M
3300009643|Ga0116110_1240926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium581Open in IMG/M
3300010048|Ga0126373_11774258All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010359|Ga0126376_11532817All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300012199|Ga0137383_10189435All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300012923|Ga0137359_10389183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1237Open in IMG/M
3300012929|Ga0137404_11423616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium640Open in IMG/M
3300012971|Ga0126369_11487519All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300014200|Ga0181526_10034274All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3273Open in IMG/M
3300014493|Ga0182016_10594707All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium630Open in IMG/M
3300014655|Ga0181516_10009740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5394Open in IMG/M
3300014658|Ga0181519_10725823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300015078|Ga0167660_1014209All Organisms → cellular organisms → Bacteria → Proteobacteria876Open in IMG/M
3300017924|Ga0187820_1166923All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300017926|Ga0187807_1222145All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium615Open in IMG/M
3300017972|Ga0187781_11423477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium513Open in IMG/M
3300018044|Ga0187890_10397858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae773Open in IMG/M
3300018482|Ga0066669_10935326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium779Open in IMG/M
3300018482|Ga0066669_11653826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300019786|Ga0182025_1364160All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300020582|Ga0210395_10021041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4800Open in IMG/M
3300021407|Ga0210383_10151774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1969Open in IMG/M
3300021478|Ga0210402_10874683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium825Open in IMG/M
3300021560|Ga0126371_11061670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-19950Open in IMG/M
3300025650|Ga0209385_1121245Not Available816Open in IMG/M
3300025906|Ga0207699_10618729All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300025911|Ga0207654_10571507Not Available805Open in IMG/M
3300025928|Ga0207700_11051273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium728Open in IMG/M
3300026277|Ga0209350_1008552All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3393Open in IMG/M
3300026291|Ga0209890_10116666Not Available913Open in IMG/M
3300026294|Ga0209839_10001683All Organisms → cellular organisms → Bacteria → Proteobacteria11179Open in IMG/M
3300026295|Ga0209234_1132526All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium904Open in IMG/M
3300026309|Ga0209055_1009061All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5374Open in IMG/M
3300026310|Ga0209239_1288291All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium567Open in IMG/M
3300026312|Ga0209153_1002440All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium6035Open in IMG/M
3300026316|Ga0209155_1167280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300026323|Ga0209472_1000322All Organisms → cellular organisms → Bacteria29092Open in IMG/M
3300026333|Ga0209158_1035336Not Available2131Open in IMG/M
3300026333|Ga0209158_1053797All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300026482|Ga0257172_1031211All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium961Open in IMG/M
3300026482|Ga0257172_1040096All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300026528|Ga0209378_1121757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1117Open in IMG/M
3300026550|Ga0209474_10068983All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2462Open in IMG/M
3300026552|Ga0209577_10118915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2118Open in IMG/M
3300027565|Ga0209219_1107491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium685Open in IMG/M
3300027648|Ga0209420_1071694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1010Open in IMG/M
3300027853|Ga0209274_10741729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium506Open in IMG/M
3300027908|Ga0209006_11058241Not Available642Open in IMG/M
3300027915|Ga0209069_10635275All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300028773|Ga0302234_10178776Not Available920Open in IMG/M
3300028795|Ga0302227_10276110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae641Open in IMG/M
3300029943|Ga0311340_11549179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium517Open in IMG/M
3300029993|Ga0302304_10216650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae709Open in IMG/M
3300029999|Ga0311339_10347259All Organisms → cellular organisms → Bacteria → Proteobacteria1571Open in IMG/M
3300030007|Ga0311338_10611132All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300030520|Ga0311372_11167864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae991Open in IMG/M
3300030617|Ga0311356_10511794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1171Open in IMG/M
3300030737|Ga0302310_10422053Not Available726Open in IMG/M
3300030991|Ga0073994_10017385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium559Open in IMG/M
3300031027|Ga0302308_10453818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium761Open in IMG/M
3300031234|Ga0302325_10005670All Organisms → cellular organisms → Bacteria → Proteobacteria28303Open in IMG/M
3300031234|Ga0302325_11979397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia720Open in IMG/M
3300031525|Ga0302326_10330526All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300031573|Ga0310915_11170756All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031753|Ga0307477_10277438All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300031754|Ga0307475_10869750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium713Open in IMG/M
3300031771|Ga0318546_10832037All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031910|Ga0306923_12561160All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031962|Ga0307479_10211550All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300032067|Ga0318524_10332438All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300032205|Ga0307472_100912302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium814Open in IMG/M
3300032770|Ga0335085_11497067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium703Open in IMG/M
3300032783|Ga0335079_11788228All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300032892|Ga0335081_11540710All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300032955|Ga0335076_10863863All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300032955|Ga0335076_11731828Not Available514Open in IMG/M
3300033402|Ga0326728_10181222All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300033824|Ga0334840_075843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae960Open in IMG/M
3300033829|Ga0334854_102019All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium688Open in IMG/M
3300033887|Ga0334790_112500Not Available865Open in IMG/M
3300034125|Ga0370484_0001384All Organisms → cellular organisms → Bacteria → Proteobacteria4348Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil21.10%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.34%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil4.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.92%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015078Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25388J43891_102962913300002909Grasslands SoilMGPSVAAPQTGTDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0062389_10382114123300004092Bog Forest SoilRAGQAPQSLSSLESGILVREDELISVKAQRLYKMRCECGRSWFELELPRFVECPACKKLGLVSA*
Ga0058899_1128015413300004631Forest SoilPRFAHKAAAGIEVREQELGAIKAQSLYKMRCECGRSWFELELPKLMICPACAKLGLVSL*
Ga0066673_1025797223300005175SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVS
Ga0066673_1070424023300005175SoilRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST*
Ga0066679_1051869523300005176SoilMGPGVAAPQTETDSGMEVHEEELRTVTAQRLYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0066678_1002659613300005181SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0066678_1070810423300005181SoilHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVSA*
Ga0066671_1031614123300005184SoilMGPSVAVPQTETDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLALVSA*
Ga0008090_1485119613300005363Tropical Rainforest SoilADLNLPAPQSAPDSGIEVHEEEWGTVTVQRLYKVRCECGRSWFELELPKFVRCPACHRLGLVSQ*
Ga0066701_1028090823300005552SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVSA*
Ga0066670_1008089333300005560SoilMEVHEEELRTVTAQRLYKMRCECGRSWFELEVPKFVECPGCHKLGLVSA*
Ga0066670_1058938723300005560SoilVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLALVSA*
Ga0066699_1117404413300005561SoilRTVSAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0066693_1001499943300005566SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST*
Ga0066702_1006497523300005575SoilMGPSVAAPQTETDSGMEVHEEELRTVSAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0066702_1098010313300005575SoilVHEEELGAVTAQRMYKMHCECGRSWFELELPRVVKCPACRKLGFVSA*
Ga0066691_1020042423300005586SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHR
Ga0066789_1034267713300005994SoilEQELGAVKAQRLFKMRCECGRSWFELELPTLVECPACKKLCLVSA*
Ga0066789_1045304213300005994SoilGIEVREEEMGSVRAQRVSKMRCDCGRSWFELELPTFVHCPACAKLCVVSM*
Ga0066790_1000496953300005995SoilVVPPEPQPKGAIGAMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPTLVECPACKKLCLVST*
Ga0066696_1062351523300006032SoilMGPSVAAPQTAADSGMEVHEEELRTVSAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0075521_1023623213300006642Arctic Peat SoilMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPILVECPACKRLCLVSA*
Ga0066665_1018681823300006796SoilMGPSVAVPQTEADSGMEVHEEELGTVTAQRLYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA*
Ga0066660_1024913523300006800SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVEC
Ga0075435_10196068023300007076Populus RhizospherePQGATASGIEVHEEKWGTVTVQHVYKMRCECGRSWFELELPRFVKCPACHKLDYVST*
Ga0066710_10145349733300009012Grasslands SoilVAAPQTETDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST
Ga0066710_10289575613300009012Grasslands SoilVAAPQTETDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0116110_124092613300009643PeatlandMPKSPPPIAALESGIVVHEEELGSVKAQRLYKMRCECGRSWFELELPTLVECPACKKLCLVTA*
Ga0126373_1177425813300010048Tropical Forest SoilEGQADLNLPAPQSAPENGIEVHEEEWGKVTVQRLYKVRCECGRSWFELELPKFVRCPACLKLGLVSQ*
Ga0126376_1153281713300010359Tropical Forest SoilKNGGGIEVHEEELCEVQAQTPYKMRCECGRSWFELELPRLVKCPACEKLGLVNK*
Ga0137383_1018943523300012199Vadose Zone SoilSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST*
Ga0137359_1038918313300012923Vadose Zone SoilQTATDSGIEVHEEELGTVTAQHVYKMRCECGRSWFELELLKFVECPACHKLSLVST*
Ga0137404_1142361613300012929Vadose Zone SoilHAGRQIGPSVAPPQTATDSGIEVHEEELGTVTAQHVYKMRCECGRSWFELELLKFVECPACHKLSLVST*
Ga0126369_1148751913300012971Tropical Forest SoilDLNLPGPQSPADSGIEVHEEEWGTVTVQPLYKMRCECGRSWFELELPKFVRCPACHRLGLVSQ*
Ga0181526_1003427433300014200BogVELKVAPPETATVSGIEVHEEKWGSVTAQRVYKMRCECGRSWFELELPKFVKCPACHKLGLISHLGCS*
Ga0182016_1059470723300014493BogVEESELGSVTAQQLFKMRCECGRSWFVLELPELIECPACRKMNLVSR*
Ga0181516_1000974043300014655BogMGQAAQPLSALDGGIVVSEEELGTVKAQRLYKMRCECGRSWFELELPTLVECPACKTLGLVSA*
Ga0181519_1072582313300014658BogPETATVSGIEVHEEKWGSVTAQRVYKMRCECGRSWFELELPKFVKCPACHKLGLISHLGCS*
Ga0167660_101420923300015078Glacier Forefield SoilMESGIVVREEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVTA*
Ga0187820_116692323300017924Freshwater SedimentPAPQSAPESGIEVHEEEWGTVTVQSLYKVRCECGRSWFELELPTFVRCPACHKFGLVSQ
Ga0187807_122214513300017926Freshwater SedimentPLKTATDGGIEVHKERLGKVAVQRLYRMRCECGRSWIALVLPKYIKCPACHKLGQIFR
Ga0187781_1142347713300017972Tropical PeatlandEEELGSAIAQHLFRMRCECGRSWFELELPKLVKCPACSRLDLVHLTIQPA
Ga0187890_1039785823300018044PeatlandSSMDSGIVVREEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVSA
Ga0066669_1093532623300018482Grasslands SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLG
Ga0066669_1165382623300018482Grasslands SoilLRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST
Ga0173482_1032816513300019361SoilREDELVQITAQRLYRLRCGCGRSWFELQLPHLVTCPACEKMGLVSP
Ga0182025_136416033300019786PermafrostVSALESDIVVREEELGTIKAQRLYKMRCECGRSWFELELPTLVECPACKKLGLVSA
Ga0210395_10021041103300020582SoilVGELNTANDTGIEVHEEEWGTVTAQVVYKMRCECGRSWFELDLLKFVECPACHKLGLISHPGQT
Ga0210383_1015177413300021407SoilTVSGIEVHEEKWGTITAQHVYKMRCECGRSWFELELPKFVRCPACHKLGLVSHPGQS
Ga0210402_1087468313300021478SoilAPPEPETDCGMEVHEEEWGTVTVQHVYKVRCGCGRSWFELESPKLVQCPACHKFGFVSS
Ga0126371_1106167013300021560Tropical Forest SoilDSGIEVTEEEWGTVTVQRLYKVRCECGRSWFELELPKFVRCPACHRVGLISQ
Ga0209385_112124513300025650Arctic Peat SoilMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPILVECPACKRLCLVSA
Ga0207699_1061872923300025906Corn, Switchgrass And Miscanthus RhizosphereDSGIEVHEEEWGTVTVQALYKMRCECGRSWFELELPKFVKCPACHKLGLVSA
Ga0207654_1057150713300025911Corn RhizosphereLDVEPPETAAPSGIEVQEEQWGSIAVQRVYKMRCECGRSWFELELPQFIRCPACHRLALISE
Ga0207700_1105127323300025928Corn, Switchgrass And Miscanthus RhizosphereNGGPPRGATASGIEVHEEKWGTVTVQHVYKMRCECGRSWFELELPRFVKCPACHKLDYVS
Ga0209350_100855213300026277Grasslands SoilMGPSVAAPQTGTDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209890_1011666623300026291SoilVVPPEPQPKGAIGAMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPTLVECPACKNLCLVST
Ga0209839_10001683113300026294SoilVVPPEPQPKGAIGAMESGIIVHEQELGAVKAQRLFKMRCECGRSWFELELPTLVECPACKKLCLVST
Ga0209234_113252613300026295Grasslands SoilMGPSVAAPQTETDSGMEVHEEELRTVSAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209055_100906143300026309SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209239_128829113300026310Grasslands SoilEVHEEELGAVTAQRMYKMHCECGRSWFELELPRVVKCPACRKLGFVSA
Ga0209153_100244033300026312SoilMGPSVAVPQTETDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLALVSA
Ga0209155_116728013300026316SoilARSTARDRGVAAPQTETDSGMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST
Ga0209472_100032293300026323SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVST
Ga0209158_103533613300026333SoilELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209158_105379723300026333SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVECPGCHKLGLVSA
Ga0257172_103121113300026482SoilALPETATDSGIEVHEEEWGTVTVQRLYKMRCECGRSWFELKVPQFVKCPACNKLGLVSR
Ga0257172_104009613300026482SoilLPETATDSGIEVHEEEWGTVTVQHLYKMRCECGRSWFELEVPQFVKCPACNKLGLVSR
Ga0209378_112175723300026528SoilMGPSVAVPQTEADSGMEVHEEELGTVTAQRLYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209474_1006898313300026550SoilMEVHEEELRTVTAQRMYKMRCECGRSWFELEVPKFVE
Ga0209577_1011891533300026552SoilMGPGVAAPQTETDSGMEVHEEELRTVTAQRLYKMRCECGRSWFELEVPKFVECPGCHRLGLVSA
Ga0209219_110749113300027565Forest SoilRVDPHVASPEPATDSGMEVHEEEWGTVTAQHLYKMRCECGRSWFELELPKFVKCPGCNKFGLVSG
Ga0209420_107169423300027648Forest SoilPISSMESGILVREEELGSVKAQRLYKMRCDCGRSWFELELPRLVECPACKKLCLVSA
Ga0209274_1074172913300027853SoilTATDSGIEVHEERLCKVTVQRLYKMRCECGRLWLAVLLPKFVKCPACHKLGIVFK
Ga0209006_1105824123300027908Forest SoilSGIDVREEELGTVTAQQVYKMRCECGRSWFELDLPTTLIKCPACAKLSLISL
Ga0209069_1063527513300027915WatershedsPQLPLVDPSVALPETATDSGIEVHEEEWGTVTVQHLYKMRCECGRSWFELELPQFVKCPACNKLGLVSW
Ga0302234_1017877613300028773PalsaMVPSQQDTEAKLAAQPLGALESGIVVREEELGACKAQRMYKMRCECGRSWFELELPTLIECPACKKLCLVSA
Ga0302227_1027611013300028795PalsaSNRRAPANASSMESGIVVREEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVSA
Ga0311340_1154917923300029943PalsaMESGIIVHEEELGSVKAQRMYKMRCDCGRSWFELELPTLVECPACKKLCLV
Ga0302304_1021665023300029993PalsaSGIVVREEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVSA
Ga0311339_1034725933300029999PalsaIDVREEELGTVTAQQLYKMRCECGRSWFELDLPTTLIKCPACAKLCLICL
Ga0311338_1061113213300030007PalsaAQPLGALESGIVVREEELGACKAQRMYKMRCECGRSWFELELPTLIECPACKKLCLVSA
Ga0311372_1116786433300030520PalsaEEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVSA
Ga0311356_1051179433300030617PalsaEAKLAAQPLGALESGIVVREEELGACKAQRMYKMRCECGRSWFELELPTLIECPACKKLCLVSA
Ga0302310_1042205323300030737PalsaMVPSQQDTEAKLAAQPLGALESGIVVREEELGACKAQRMYKMRCECGRSWFELELPTLIECPAC
Ga0073994_1001738513300030991SoilGIEVHEEELGAVTAQRVYKMHCECGRSWFELELPRVVKCPACRKLGFVSV
Ga0302308_1045381813300031027PalsaREEELGACKAQRMYKMRCECGRSWFELELPTLIECPACKKLCLVSA
Ga0302325_10005670223300031234PalsaMESGIIVHEEELGSVKAQRMYKMRCDCGRSWFELELPTLVECPACKKLCLVSA
Ga0302325_1197939713300031234PalsaIEVQEEELCAVKAQVLFKMRCECGRSWFELELPRLVKCPACDKLGLVSS
Ga0302326_1033052653300031525PalsaALESGIVVREEELGACKAQRMYKMRCECGRSWFELELPTLIECPACKKLCLVSA
Ga0310915_1117075613300031573SoilLNLPAAPNASDSGIEVHEEEWGTVTVQRLYKVRCQCGRSWFELDLPKFVRCPACHKLGLVSQ
Ga0307477_1027743823300031753Hardwood Forest SoilMEVHEEDLGTVTALRIYKMRCECGRSWFELELPKFVECPGCHKLGFVSA
Ga0307475_1086975013300031754Hardwood Forest SoilEVREEELGEVSAQRMYKMRCECGRSWFELELPQVVKCPACRKVGLVSASQGPRRRAPMPA
Ga0318546_1083203713300031771SoilRGADLDLPAAQSPSDSGIEVHEEEWGTVTVQRLYKMRCECGRSWFELELPKFVRCPACHKLGLVSQ
Ga0306923_1256116023300031910SoilDSGIEVHEEESGTVTVQRLYKVRCQCGRSWFELDLPKFVRCPACHKLGLVSQ
Ga0307479_1021155043300031962Hardwood Forest SoilPTETATDSGIEVHEEEWGTVTVQHVYKMRCECGRSWFELEVPKVVKCPACNKFGFVSS
Ga0318524_1033243823300032067SoilLNLPAAPNASDSGIEVHEEEWGTVTVQRLYKVRCECGRSWFELDLPKFVRCPACHKLGLVSQ
Ga0307472_10091230223300032205Hardwood Forest SoilLPQGATASGIEVHEEKWGTVTVQHVYKMRCECGRSWFELELPRFVKCPACHKLDYVST
Ga0335085_1149706723300032770SoilTASGIEVHEEKWGTVTVQHVYKMRCECGRSWFELELLRFVKCPACHKLDYVCR
Ga0335079_1178822823300032783SoilGGIEVQEEELSTITAQKLYKMRCECGRSWFELELSRLAKCPACSKIGVVDNGTG
Ga0335081_1154071023300032892SoilQGGIEVHEEELSTITAQKLYQMRCECGRSWFELELSRLAKCPACSKIGVVDNGTG
Ga0335076_1086386313300032955SoilEVHEEELSTITAQKLYQMRCECGRSWFELELSRLAKCPACSKIGVVDNGTG
Ga0335076_1173182813300032955SoilALESGIVVREEELGTVRAQRLYKMRCECGRSWFELELPKLVECPACKRLCLVSA
Ga0326728_1018122233300033402Peat SoilENGITVSEQELGSVKAQRLYKMRCDCGRSWFELELPRLVECPACRKLCLVSA
Ga0334840_075843_696_8573300033824SoilMDSGIVVREEELIAVKAQRLFKMRCECGRSWFELELPKFVECPACKKLGLVSA
Ga0334854_102019_536_6883300033829SoilGIEVHEGELGSVMAQRLYKMRCECGRSWFELELPRLVQCPACLRLNLVSV
Ga0334790_112500_278_4813300033887SoilVVPPEPQPKGAIGAMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPILVECPACKRLCLVSA
Ga0370484_0001384_1692_18953300034125Untreated Peat SoilVVPPEPQPKGAIGAMESGIVVHEQELGAVKAQRLFKMRCECGRSWFELELPTLVECPACKKLCLVSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.