Basic Information | |
---|---|
Family ID | F088695 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 40 residues |
Representative Sequence | GLADMLLGWVAGPLPPVDPRQEGLVQQLRAERLAAQGAPA |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.17 % |
% of genes from short scaffolds (< 2000 bps) | 92.66 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.890 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.853 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.101 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.459 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF02635 | DrsE | 52.29 |
PF08768 | THAP4_heme-bd | 6.42 |
PF08669 | GCV_T_C | 3.67 |
PF13602 | ADH_zinc_N_2 | 2.75 |
PF02720 | DUF222 | 1.83 |
PF13649 | Methyltransf_25 | 1.83 |
PF00202 | Aminotran_3 | 1.83 |
PF13519 | VWA_2 | 0.92 |
PF08353 | MurT_C | 0.92 |
PF05598 | DUF772 | 0.92 |
PF00440 | TetR_N | 0.92 |
PF08388 | GIIM | 0.92 |
PF03176 | MMPL | 0.92 |
PF13006 | Nterm_IS4 | 0.92 |
PF12900 | Pyridox_ox_2 | 0.92 |
PF04672 | Methyltransf_19 | 0.92 |
PF00037 | Fer4 | 0.92 |
PF11829 | DUF3349 | 0.92 |
PF08240 | ADH_N | 0.92 |
PF08734 | GYD | 0.92 |
PF00085 | Thioredoxin | 0.92 |
PF13540 | RCC1_2 | 0.92 |
PF02585 | PIG-L | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.92 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.92 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.92 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.89 % |
All Organisms | root | All Organisms | 32.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_152611 | Not Available | 759 | Open in IMG/M |
3300005451|Ga0066681_10768852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300005537|Ga0070730_10141102 | Not Available | 1640 | Open in IMG/M |
3300005610|Ga0070763_10714820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300005614|Ga0068856_100807712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 957 | Open in IMG/M |
3300005712|Ga0070764_10678234 | Not Available | 633 | Open in IMG/M |
3300005764|Ga0066903_104523393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
3300005764|Ga0066903_106917161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300006052|Ga0075029_100308952 | Not Available | 1011 | Open in IMG/M |
3300006755|Ga0079222_10453375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 918 | Open in IMG/M |
3300006893|Ga0073928_10477233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 898 | Open in IMG/M |
3300006914|Ga0075436_100304903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
3300006914|Ga0075436_101199686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 573 | Open in IMG/M |
3300006954|Ga0079219_10098498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1429 | Open in IMG/M |
3300006954|Ga0079219_10903569 | Not Available | 714 | Open in IMG/M |
3300009029|Ga0066793_10886692 | Not Available | 505 | Open in IMG/M |
3300009038|Ga0099829_10900605 | Not Available | 734 | Open in IMG/M |
3300009038|Ga0099829_11526904 | Not Available | 551 | Open in IMG/M |
3300009520|Ga0116214_1145794 | Not Available | 880 | Open in IMG/M |
3300009521|Ga0116222_1020872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2969 | Open in IMG/M |
3300010362|Ga0126377_11483331 | Not Available | 752 | Open in IMG/M |
3300010366|Ga0126379_13368452 | Not Available | 535 | Open in IMG/M |
3300010379|Ga0136449_100553618 | Not Available | 1977 | Open in IMG/M |
3300010379|Ga0136449_104075708 | Not Available | 544 | Open in IMG/M |
3300010876|Ga0126361_10446965 | Not Available | 621 | Open in IMG/M |
3300010876|Ga0126361_10504807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300011106|Ga0151489_1532777 | Not Available | 667 | Open in IMG/M |
3300012202|Ga0137363_10734248 | Not Available | 836 | Open in IMG/M |
3300012354|Ga0137366_10056481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3003 | Open in IMG/M |
3300012356|Ga0137371_10380846 | Not Available | 1095 | Open in IMG/M |
3300012483|Ga0157337_1039559 | Not Available | 515 | Open in IMG/M |
3300012971|Ga0126369_11130199 | Not Available | 873 | Open in IMG/M |
3300016270|Ga0182036_11381514 | Not Available | 589 | Open in IMG/M |
3300016294|Ga0182041_12010241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300016445|Ga0182038_11142607 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300017823|Ga0187818_10112262 | Not Available | 1180 | Open in IMG/M |
3300017924|Ga0187820_1163478 | Not Available | 677 | Open in IMG/M |
3300017955|Ga0187817_10846394 | Not Available | 584 | Open in IMG/M |
3300017973|Ga0187780_10407274 | Not Available | 965 | Open in IMG/M |
3300017975|Ga0187782_11628939 | Not Available | 510 | Open in IMG/M |
3300018001|Ga0187815_10441253 | Not Available | 556 | Open in IMG/M |
3300018007|Ga0187805_10202362 | Not Available | 907 | Open in IMG/M |
3300018043|Ga0187887_10122848 | Not Available | 1559 | Open in IMG/M |
3300018047|Ga0187859_10223368 | Not Available | 1007 | Open in IMG/M |
3300018058|Ga0187766_10571612 | Not Available | 769 | Open in IMG/M |
3300018085|Ga0187772_10568001 | Not Available | 805 | Open in IMG/M |
3300018085|Ga0187772_11085002 | Not Available | 587 | Open in IMG/M |
3300020579|Ga0210407_10462296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 992 | Open in IMG/M |
3300020582|Ga0210395_10162248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1671 | Open in IMG/M |
3300021178|Ga0210408_10103349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2240 | Open in IMG/M |
3300021181|Ga0210388_10836850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 796 | Open in IMG/M |
3300021401|Ga0210393_10500680 | Not Available | 992 | Open in IMG/M |
3300021403|Ga0210397_10854674 | Not Available | 703 | Open in IMG/M |
3300021403|Ga0210397_11391265 | Not Available | 545 | Open in IMG/M |
3300023056|Ga0233357_1004384 | Not Available | 1336 | Open in IMG/M |
3300025320|Ga0209171_10395006 | Not Available | 710 | Open in IMG/M |
3300025633|Ga0208480_1140228 | Not Available | 553 | Open in IMG/M |
3300025898|Ga0207692_10577648 | Not Available | 721 | Open in IMG/M |
3300025906|Ga0207699_10324292 | Not Available | 1081 | Open in IMG/M |
3300025911|Ga0207654_11455325 | Not Available | 500 | Open in IMG/M |
3300025929|Ga0207664_10601730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
3300026551|Ga0209648_10178234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1647 | Open in IMG/M |
3300027096|Ga0208099_1013110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1121 | Open in IMG/M |
3300027371|Ga0209418_1072743 | Not Available | 616 | Open in IMG/M |
3300027641|Ga0208827_1002291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 7976 | Open in IMG/M |
3300027641|Ga0208827_1190910 | Not Available | 549 | Open in IMG/M |
3300027787|Ga0209074_10261397 | Not Available | 677 | Open in IMG/M |
3300027857|Ga0209166_10587801 | Not Available | 567 | Open in IMG/M |
3300027911|Ga0209698_10361296 | Not Available | 1140 | Open in IMG/M |
3300028780|Ga0302225_10096846 | Not Available | 1444 | Open in IMG/M |
3300028789|Ga0302232_10544742 | Not Available | 570 | Open in IMG/M |
3300028801|Ga0302226_10097728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. KC721 | 1311 | Open in IMG/M |
3300028801|Ga0302226_10329130 | Not Available | 642 | Open in IMG/M |
3300028877|Ga0302235_10235040 | Not Available | 801 | Open in IMG/M |
3300028877|Ga0302235_10292367 | Not Available | 705 | Open in IMG/M |
3300028881|Ga0307277_10021187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2547 | Open in IMG/M |
3300029951|Ga0311371_11662481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
3300030054|Ga0302182_10295830 | Not Available | 683 | Open in IMG/M |
3300030056|Ga0302181_10499936 | Not Available | 512 | Open in IMG/M |
3300030057|Ga0302176_10066859 | Not Available | 1388 | Open in IMG/M |
3300030057|Ga0302176_10169279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d | 868 | Open in IMG/M |
3300030520|Ga0311372_13031724 | Not Available | 507 | Open in IMG/M |
3300031543|Ga0318516_10718285 | Not Available | 567 | Open in IMG/M |
3300031561|Ga0318528_10722559 | Not Available | 533 | Open in IMG/M |
3300031572|Ga0318515_10630186 | Not Available | 569 | Open in IMG/M |
3300031681|Ga0318572_10017581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3534 | Open in IMG/M |
3300031681|Ga0318572_10100337 | Not Available | 1633 | Open in IMG/M |
3300031723|Ga0318493_10671806 | Not Available | 580 | Open in IMG/M |
3300031748|Ga0318492_10805558 | Not Available | 506 | Open in IMG/M |
3300031751|Ga0318494_10201699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1133 | Open in IMG/M |
3300031769|Ga0318526_10095564 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300031769|Ga0318526_10218768 | Not Available | 779 | Open in IMG/M |
3300031782|Ga0318552_10015575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3276 | Open in IMG/M |
3300031782|Ga0318552_10664094 | Not Available | 532 | Open in IMG/M |
3300031797|Ga0318550_10597880 | Not Available | 530 | Open in IMG/M |
3300031799|Ga0318565_10349494 | Not Available | 717 | Open in IMG/M |
3300032008|Ga0318562_10107708 | Not Available | 1586 | Open in IMG/M |
3300032009|Ga0318563_10768023 | Not Available | 517 | Open in IMG/M |
3300032055|Ga0318575_10605390 | Not Available | 555 | Open in IMG/M |
3300032066|Ga0318514_10742156 | Not Available | 522 | Open in IMG/M |
3300032076|Ga0306924_12110449 | Not Available | 577 | Open in IMG/M |
3300032160|Ga0311301_10266475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2797 | Open in IMG/M |
3300032261|Ga0306920_100500090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1804 | Open in IMG/M |
3300032805|Ga0335078_11586153 | Not Available | 726 | Open in IMG/M |
3300032828|Ga0335080_11777209 | Not Available | 602 | Open in IMG/M |
3300032896|Ga0335075_10281301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1881 | Open in IMG/M |
3300032955|Ga0335076_10781833 | Not Available | 836 | Open in IMG/M |
3300033134|Ga0335073_10575217 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300033806|Ga0314865_112009 | Not Available | 719 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.85% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.01% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.83% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.92% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_02512370 | 2199352025 | Soil | MLLGWVAGPLPPVDPRQEGLVQQLRAERLAAQGAPA |
Ga0066681_107688522 | 3300005451 | Soil | GLADMLLGWVAGPLPPVDPRQEGLVQQLRAERLAAQGAPA* |
Ga0070730_101411024 | 3300005537 | Surface Soil | LADLLLGWVAGSLPPVDPRQEELVQTLRRERLATQGTSA* |
Ga0070763_107148201 | 3300005610 | Soil | SLADLLLSWVTGPLPPIDPRQDELVQSLRGERLATQGTTAPR* |
Ga0068856_1008077124 | 3300005614 | Corn Rhizosphere | LVRNPGLADMLLGWVVGTLPPLNPGQEDLVQKLRAERLAAQGAPA* |
Ga0070764_106782342 | 3300005712 | Soil | SLADLLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQSSPA* |
Ga0066903_1045233932 | 3300005764 | Tropical Forest Soil | VRNPGLADMLLGWVVGTLPPADPRQEDLVQKLRAERLAAQGAHA* |
Ga0066903_1069171611 | 3300005764 | Tropical Forest Soil | PGLADMLLGWVAGPLPPVDPRQEGLVQQLRAERLAAQGAAAVG* |
Ga0075029_1003089524 | 3300006052 | Watersheds | GLADMLLGWVVGTLPPVDPRQEDLVLKLRADRLAAQGVPG* |
Ga0079222_104533754 | 3300006755 | Agricultural Soil | RNPGLADMLLGWVAGSLPPVDPRQEDLVQQLRAERLAAQGAPA* |
Ga0073928_104772332 | 3300006893 | Iron-Sulfur Acid Spring | LVRNPSLADLLLTWVAGTLPPIDPRQEELVQVLRRDRLAAQGAPAP* |
Ga0075436_1003049032 | 3300006914 | Populus Rhizosphere | ADMLLGWVTGPLPAIDPRQEDLVTRLRADRLAAVQPAPA* |
Ga0075436_1011996861 | 3300006914 | Populus Rhizosphere | ALVRNPGLADMLLGWVAGTLPPVDPAQEALVQQLRAERLAAQGAPA* |
Ga0079219_100984984 | 3300006954 | Agricultural Soil | VRNPGLADMLLGWVAGSLPPVDPRQEDLVQQLRAERLAAQGAPA* |
Ga0079219_109035693 | 3300006954 | Agricultural Soil | MLLGWVTGPLPAIDPRQEDLVTRLRADRLAAAQPAPA* |
Ga0066793_108866921 | 3300009029 | Prmafrost Soil | LLSWVAGPLPALDPQQEDLVLKLRGERLAAQGAPAQ* |
Ga0099829_109006053 | 3300009038 | Vadose Zone Soil | GLADMLLGWVVGTLPTVDPRHENLVLKLRADRLAAQAAQ* |
Ga0099829_115269042 | 3300009038 | Vadose Zone Soil | VRNPGLADLLLGWVVGTLPPIDPRQEELVLKLRADRLAGQGAPG* |
Ga0116214_11457941 | 3300009520 | Peatlands Soil | PGLADLLLSWVVGTLPPIDPRQEELVQGLRHERLAAQPATA* |
Ga0116222_10208721 | 3300009521 | Peatlands Soil | PGLADLLLSWVVGTLPPIDPRQEELVQGLRRERLAAQPATA* |
Ga0126377_114833311 | 3300010362 | Tropical Forest Soil | ADMLLGWVVGTLAPVDPRQEELVQKLRAERLAAQGAPA* |
Ga0126379_133684522 | 3300010366 | Tropical Forest Soil | LLGWVVGTLAPVDPRQEELVQKLRAERLAAQGTPA* |
Ga0136449_1005536181 | 3300010379 | Peatlands Soil | LADLLLGWVAGPLRPLPAESDELALTLRRERLAAVAP* |
Ga0136449_1040757082 | 3300010379 | Peatlands Soil | ALVRNPGLADMLLGWVVGTLPPVDPRQEDLVLKLRADRLTAQGVPG* |
Ga0126361_104469651 | 3300010876 | Boreal Forest Soil | LADLLLSWVTGPLRPADPRQEELVQTLRRERLATSAAPG* |
Ga0126361_105048072 | 3300010876 | Boreal Forest Soil | VRNPSLADLLLSWVVGPLPPVDPRQDELVQTLRRERLATQATPS* |
Ga0151489_15327772 | 3300011106 | Soil | LADMLLSWVVGTLPPVDPRHEDLVRRLRADRLAAQGAGPPQ* |
Ga0137363_107342483 | 3300012202 | Vadose Zone Soil | LVRNPGLADMLLGWVAGSLPPVDPRQEALVQQLRAERLAARATPA* |
Ga0137366_100564811 | 3300012354 | Vadose Zone Soil | NPALADMLLGWVVGTLPPVDPRYEDLVLKLRADRLAAQGAPPS* |
Ga0137371_103808461 | 3300012356 | Vadose Zone Soil | ADMLLGWVAGTLPPVDPRQEGLVQQLRAERLAAQGAPA* |
Ga0157337_10395591 | 3300012483 | Arabidopsis Rhizosphere | GLADMLLGWVAGPLPPVDPQQEGLVQQLRAERLAAQGAPA* |
Ga0126369_111301992 | 3300012971 | Tropical Forest Soil | DMLLGWVVGTLPPVDPRQEELVQKLRAERLAAQGTPA* |
Ga0182036_113815142 | 3300016270 | Soil | ADMLLGWVVGTLPPVDPRQEDLVQQLRAERLAAQGTQ |
Ga0182041_120102412 | 3300016294 | Soil | ADLLLGWVAGSLPPIDPRQEELVLDLRRERLAAVQGTSA |
Ga0182038_111426071 | 3300016445 | Soil | DLLLSWVVGTLPPIDPRQEELVQSLRGERLAAQGAAV |
Ga0187818_101122621 | 3300017823 | Freshwater Sediment | GLADLLLSWVVGTLPPIDPRQEELVQGLRHERLAAQPATA |
Ga0187820_11634782 | 3300017924 | Freshwater Sediment | LADLLLGWVAGPLPAIDPRQEELVLNLRHERLAAQPG |
Ga0187817_108463941 | 3300017955 | Freshwater Sediment | ADLLLSWVVGTLPPIDPRQEDLVQGLRRERLAAQASVD |
Ga0187780_104072743 | 3300017973 | Tropical Peatland | LADLLLSWIVGSLPPIDPRQEELVLSLRQERLAAQGATA |
Ga0187782_116289391 | 3300017975 | Tropical Peatland | ADLLLGWAAGPLPPIDPRQEELVLNLRRERLAAVPGAIS |
Ga0187815_104412531 | 3300018001 | Freshwater Sediment | LADLLLSWVVGTLPPIDPRQEELVQGLRCERLAAQGATA |
Ga0187805_102023621 | 3300018007 | Freshwater Sediment | LVRNPGLADLLLRWVAGTLSEIDPRQEELVLNLRHERLAAQPG |
Ga0187887_101228482 | 3300018043 | Peatland | LVRNPSLADLLLSWVAGPLPAIDPRQEDLVLQLRGERLAAHGGPA |
Ga0187859_102233682 | 3300018047 | Peatland | ADLLLSWAAGPLPAIDSRQEDLVAQLRADRLAAAQPAPA |
Ga0187766_105716123 | 3300018058 | Tropical Peatland | RNPSLADLLLGWVAGTLPPIDPAREELVQNLRRERLAAQTRSGS |
Ga0187772_105680011 | 3300018085 | Tropical Peatland | PGLADLLLGWIAGSLPPIDPRQEELVLNLRHERLAAVPGTSA |
Ga0187772_110850022 | 3300018085 | Tropical Peatland | VRNPGLADLLLSWVVGTLPPVDPAREELVQNLRRERLAAHAAT |
Ga0210407_104622963 | 3300020579 | Soil | DLLLGWVAGTLPPIDPRQEELVQNLRRERLATQGAPS |
Ga0210395_101622481 | 3300020582 | Soil | DLLLSWVVGTLPPVDPRQEELVRKLRADRLAAQGAPA |
Ga0210408_101033491 | 3300021178 | Soil | LVRNPGLADMLLGWVAGTLPPVDPGQEGLVQQLRAERLAAQGAPA |
Ga0210388_108368503 | 3300021181 | Soil | LLSWVTGPLPPIDPRQEELVQSLRRERLATQAATAQR |
Ga0210393_105006801 | 3300021401 | Soil | LLLSWVTGPLPPIDPRQDELVQSLRRERLATQGTSA |
Ga0210397_108546741 | 3300021403 | Soil | ADLLLGWVAGTLPPIDPRQEELVQNLRRERLATQGAPS |
Ga0210397_113912651 | 3300021403 | Soil | SLADLLLSWVTGPLPPIDPRQDELVQSLRRERLATQGTSA |
Ga0233357_10043841 | 3300023056 | Soil | GLADLLLGWVTGPLRPLPPAGDDLSLRLRQERLAAVSSR |
Ga0209171_103950062 | 3300025320 | Iron-Sulfur Acid Spring | LLLTWVAGTLPPVDPRQEELVQTLRRDRLAAVGATAP |
Ga0208480_11402281 | 3300025633 | Arctic Peat Soil | LVRNPSLADMLLRWVVGPLPALDPRQEELVLKLRGERLAGQAVSA |
Ga0207692_105776482 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LGWVAGPLPAIDSRQEDLVTQLRADRLAAAQPAPA |
Ga0207699_103242924 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DMLLGWVAGALPPVDPGQEGLVQQLRAERLAAQGASA |
Ga0207654_114553252 | 3300025911 | Corn Rhizosphere | VRNPGLADMLLGWVAGPLPPVDPQQEGLVQQLRAERLAAQGAPA |
Ga0207664_106017301 | 3300025929 | Agricultural Soil | DMLLGWVTGPLPAIDPRQEDLVTRLRADRLAAAQPAPA |
Ga0209648_101782343 | 3300026551 | Grasslands Soil | MLLSWVVGTLPPVDPRQEDLVLKLRAERLAAQGAPAP |
Ga0208099_10131102 | 3300027096 | Forest Soil | LADLLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQSNPA |
Ga0209418_10727432 | 3300027371 | Forest Soil | DMLLGWVVGTLPPVDPRQEELVQKLRAERLAAQGAPAQPN |
Ga0208827_100229111 | 3300027641 | Peatlands Soil | ADMLLGWVAGTLPPVDPRQEDLVLKLRADRLAAQSVPG |
Ga0208827_11909101 | 3300027641 | Peatlands Soil | ADLLLGWVAGTLPAIDPRHEELVLNLRRERLAAQPG |
Ga0209074_102613971 | 3300027787 | Agricultural Soil | RNPGLADMLLGWVAGSLPPVDPRQEDLVQQLRAERLAAQGAPA |
Ga0209166_105878012 | 3300027857 | Surface Soil | LVRNPGLADLLLGWVAGSLPPVDPRQEELVQTLRRERLATQGTSA |
Ga0209698_103612964 | 3300027911 | Watersheds | RNPGLADMLLGWVAGTLPPADPRQEDLVLKLRADRLAAQSVPG |
Ga0302225_100968464 | 3300028780 | Palsa | LLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQSGPA |
Ga0302232_105447421 | 3300028789 | Palsa | VRNPSLADLLLSWVAGPLPAIDPRQEDLVLQLRGERLAAHGGPA |
Ga0302226_100977281 | 3300028801 | Palsa | ADLLLSWVAGPLPAIDPRQEDLVLKLRRERLAAQSSPA |
Ga0302226_103291302 | 3300028801 | Palsa | PSLADLLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQLD |
Ga0302235_102350401 | 3300028877 | Palsa | MLLRWVTGSLPALDPQQEDLVLKLRGERLAAQPVSA |
Ga0302235_102923671 | 3300028877 | Palsa | LLSWVVGPLPPIDPRQEDLVQTLRRERLAATPAPS |
Ga0307277_100211876 | 3300028881 | Soil | LLGWVAGSLPPVDPRQEALVQQLRAERLAAQGAPA |
Ga0311371_116624811 | 3300029951 | Palsa | VLVRNPSLADLLLSWVTGPLPAIDPRQEDLVLQLRGERLAAQSGPA |
Ga0302182_102958301 | 3300030054 | Palsa | PSLADLLLSWVVGPLPPIDPRQEDLVQTLRRERLAATPAPS |
Ga0302181_104999362 | 3300030056 | Palsa | PGLADLLLSWVVGPLPPIDPRQEDLVQTLRRERLAATPAPS |
Ga0302176_100668594 | 3300030057 | Palsa | DLLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQLD |
Ga0302176_101692791 | 3300030057 | Palsa | PSLADLLLSWVAGPLPAIDPRQEDLVLKLRGERLAAQSGPA |
Ga0311372_130317241 | 3300030520 | Palsa | NPSLADLLLGWVAGPLPAIDPRQEDLVLQLRGERLAAQSGQA |
Ga0318516_107182851 | 3300031543 | Soil | ADLLLSWVVGTLPPIDPRQEELVQSLRGERFAAQGATA |
Ga0318528_107225591 | 3300031561 | Soil | LLGWVAGPLPQVDPRQEELVQKLRAERLAAQGTPA |
Ga0318515_106301861 | 3300031572 | Soil | ADMLLGWVVGTLPPVDPRQEELVQKLRAERLAAQGTPA |
Ga0318572_100175811 | 3300031681 | Soil | MLLGWVVGTLAPVDPRQEDLVQQLRAERLAAQGTQ |
Ga0318572_101003374 | 3300031681 | Soil | ADLLLGWVAGPLPPVEPRQEDLVLKLRAERLAALGAPG |
Ga0318493_106718062 | 3300031723 | Soil | LSWVAGTLPPIDPRQEELVLGLRQERLAAQGASGQ |
Ga0318492_108055582 | 3300031748 | Soil | PGLADMLLGWVAGSLPPVDPRQEDLVQQLRAERLAAQGAPA |
Ga0318494_102016993 | 3300031751 | Soil | PSLADLLLSWVVGTLPPIDPRQEELVQSLRGERFAAQGATA |
Ga0318526_100955641 | 3300031769 | Soil | PSLADLLLSWVVGTLPPIDPRQEKLVQSLRRERFAAQGATV |
Ga0318526_102187681 | 3300031769 | Soil | LVRNPSLADLLLSWVVGTLPPIDPRQEELVQSLRGERFAAQGATA |
Ga0318552_100155751 | 3300031782 | Soil | DMLLGWVVGTLPPVDPRREDLVHKLRAERLAAQGAPA |
Ga0318552_106640941 | 3300031782 | Soil | SLADLLLSWVVGTLPPIDPRQEELVQSLRGERFAAQGATA |
Ga0318550_105978801 | 3300031797 | Soil | VRNPGLADMLLGWVVGTLPPVDPRREDLVHKLRAERLAAQGAPA |
Ga0318565_103494942 | 3300031799 | Soil | PGLADLLLGWVAGPLPPVEPRQEDLVLKLRAERLAALGAPG |
Ga0318562_101077084 | 3300032008 | Soil | VRNPGLADLLLGWVAGSLPPIDPRQEELVLGLRHERLAAVQGTGG |
Ga0318563_107680232 | 3300032009 | Soil | VRNPGLADLLLGWVVGALPPVDPRQEDLVLKLRADRLAAQGVPA |
Ga0318575_106053901 | 3300032055 | Soil | GLADMLLGWVVGTLPEVDPRQEELVQKLRAERLAAQGAPA |
Ga0318514_107421561 | 3300032066 | Soil | LVRNPSLADLLLSWVVGTLPPIDPRQEELVQSLRGERFAAQGAAV |
Ga0306924_121104491 | 3300032076 | Soil | LLLSWVAGTLPPIDPRQEELVLGLRQERLAAQGASGQ |
Ga0311301_102664756 | 3300032160 | Peatlands Soil | PGLADLLLSWVAGTLPPIDPRQEELVLSLRHERLAAQGATA |
Ga0306920_1005000905 | 3300032261 | Soil | ALVRNPGLADLLLGWVVGTLPPIDPRQEELVQSLRGERFAAQGAAV |
Ga0335078_115861532 | 3300032805 | Soil | LADLLLGWVTGPLPPIDPRQEELVLGLRRERLAAQPTTA |
Ga0335080_117772091 | 3300032828 | Soil | PGLADLLLGWVAGPLPPADPRQEDLVLRLRADRLAAQGAW |
Ga0335075_102813013 | 3300032896 | Soil | NPGLADLLLGWVAGPLPPIDPRQEELVLSLRRERLSAQLATA |
Ga0335076_107818331 | 3300032955 | Soil | ALVRNPGLADMLLGWVAGTLPPADPRQEDLVLKLRADRLAAQSVPG |
Ga0335073_105752171 | 3300033134 | Soil | RNPSLADLLLSWVVGTLPPVEPRHEELVQTLRRERIAAQPAPA |
Ga0314865_112009_572_682 | 3300033806 | Peatland | MLLGWVVGTLPPADPRQEDLVRKLRAERLAAQGAPA |
⦗Top⦘ |