Basic Information | |
---|---|
Family ID | F088689 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 47 residues |
Representative Sequence | LLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 4.11 % |
% of genes near scaffold ends (potentially truncated) | 64.22 % |
% of genes from short scaffolds (< 2000 bps) | 66.97 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.890 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (10.092 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.936 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (23.853 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF06782 | UPF0236 | 14.68 |
PF00483 | NTP_transferase | 0.92 |
PF14331 | IcmF-related_N | 0.92 |
PF04055 | Radical_SAM | 0.92 |
PF00005 | ABC_tran | 0.92 |
PF13472 | Lipase_GDSL_2 | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.89 % |
All Organisms | root | All Organisms | 32.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003432|JGI20214J51088_10252888 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1222 | Open in IMG/M |
3300003432|JGI20214J51088_10544258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 740 | Open in IMG/M |
3300004067|Ga0055485_10046512 | Not Available | 968 | Open in IMG/M |
3300004779|Ga0062380_10542463 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005437|Ga0070710_10296535 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300005445|Ga0070708_101762922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 575 | Open in IMG/M |
3300005536|Ga0070697_102080746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 508 | Open in IMG/M |
3300005831|Ga0074471_10103503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 573 | Open in IMG/M |
3300005921|Ga0070766_10834698 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300006031|Ga0066651_10543359 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300006057|Ga0075026_100660833 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300006755|Ga0079222_11283377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 665 | Open in IMG/M |
3300006806|Ga0079220_11169467 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300006880|Ga0075429_101245714 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300006881|Ga0068865_102118703 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006893|Ga0073928_10271820 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300009009|Ga0105105_10527819 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 679 | Open in IMG/M |
3300009156|Ga0111538_13224720 | Not Available | 568 | Open in IMG/M |
3300009167|Ga0113563_13426236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 537 | Open in IMG/M |
3300009167|Ga0113563_13729815 | Not Available | 516 | Open in IMG/M |
3300009527|Ga0114942_1281625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
3300010341|Ga0074045_10124720 | Not Available | 1766 | Open in IMG/M |
3300010375|Ga0105239_13335497 | Not Available | 522 | Open in IMG/M |
3300010399|Ga0134127_10524140 | Not Available | 1201 | Open in IMG/M |
3300010403|Ga0134123_10363449 | Not Available | 1312 | Open in IMG/M |
3300010403|Ga0134123_13140828 | Not Available | 531 | Open in IMG/M |
3300011414|Ga0137442_1034941 | Not Available | 962 | Open in IMG/M |
3300011439|Ga0137432_1049095 | Not Available | 1269 | Open in IMG/M |
3300012035|Ga0137445_1105437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 572 | Open in IMG/M |
3300012212|Ga0150985_108122097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 652 | Open in IMG/M |
3300012929|Ga0137404_10968624 | Not Available | 778 | Open in IMG/M |
3300012929|Ga0137404_11150191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 713 | Open in IMG/M |
3300014165|Ga0181523_10728319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 541 | Open in IMG/M |
3300014319|Ga0075348_1223430 | Not Available | 529 | Open in IMG/M |
3300014490|Ga0182010_10426491 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
3300014870|Ga0180080_1083562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 558 | Open in IMG/M |
3300015264|Ga0137403_10826198 | Not Available | 780 | Open in IMG/M |
3300017654|Ga0134069_1145568 | Not Available | 790 | Open in IMG/M |
3300018063|Ga0184637_10324905 | Not Available | 929 | Open in IMG/M |
3300018083|Ga0184628_10644170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 532 | Open in IMG/M |
3300019882|Ga0193713_1203424 | Not Available | 504 | Open in IMG/M |
3300019999|Ga0193718_1088527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
3300021363|Ga0193699_10073084 | Not Available | 1356 | Open in IMG/M |
3300021520|Ga0194053_10057522 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1695 | Open in IMG/M |
3300025935|Ga0207709_10695950 | Not Available | 813 | Open in IMG/M |
3300026486|Ga0256820_1013332 | Not Available | 1100 | Open in IMG/M |
3300026501|Ga0256806_1027097 | Not Available | 994 | Open in IMG/M |
3300027070|Ga0208365_1029826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 717 | Open in IMG/M |
3300027831|Ga0209797_10446019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 520 | Open in IMG/M |
3300028380|Ga0268265_10328033 | Not Available | 1389 | Open in IMG/M |
3300028380|Ga0268265_10871696 | Not Available | 882 | Open in IMG/M |
3300028556|Ga0265337_1057244 | Not Available | 1085 | Open in IMG/M |
3300029990|Ga0311336_10383494 | Not Available | 1176 | Open in IMG/M |
3300030047|Ga0302286_10229481 | Not Available | 935 | Open in IMG/M |
3300030294|Ga0311349_10524533 | Not Available | 1120 | Open in IMG/M |
3300030294|Ga0311349_11235595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
3300031232|Ga0302323_101163338 | Not Available | 861 | Open in IMG/M |
3300031236|Ga0302324_101151897 | Not Available | 1038 | Open in IMG/M |
3300031525|Ga0302326_10633142 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300031711|Ga0265314_10188062 | Not Available | 1231 | Open in IMG/M |
3300031718|Ga0307474_10292028 | Not Available | 1255 | Open in IMG/M |
3300031997|Ga0315278_11289822 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 712 | Open in IMG/M |
3300032143|Ga0315292_10675004 | Not Available | 869 | Open in IMG/M |
3300032163|Ga0315281_10863411 | Not Available | 928 | Open in IMG/M |
3300032164|Ga0315283_11187809 | Not Available | 797 | Open in IMG/M |
3300032164|Ga0315283_11306512 | Not Available | 752 | Open in IMG/M |
3300032256|Ga0315271_10288042 | Not Available | 1347 | Open in IMG/M |
3300032256|Ga0315271_11745194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 534 | Open in IMG/M |
3300032275|Ga0315270_11138912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 519 | Open in IMG/M |
3300032893|Ga0335069_11144147 | Not Available | 855 | Open in IMG/M |
3300033412|Ga0310810_10787538 | Not Available | 862 | Open in IMG/M |
3300033418|Ga0316625_100742889 | Not Available | 831 | Open in IMG/M |
3300033483|Ga0316629_11260075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 593 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.09% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.42% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.50% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.83% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.83% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.83% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.83% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.92% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.92% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.92% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.92% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026486 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6 | Environmental | Open in IMG/M |
3300026501 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4 | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWSO_07557450 | 2088090005 | Freshwater Sediment | RLILELRQLGNSSMNQWATQAEERVSAELKGQDATVRSRKKKR |
deepsgr_00242450 | 2199352025 | Soil | LIHELRQLGSTTMNQWAVQAEERVSAELQAQDVTVRGLXXXR |
JGI20214J51088_102528881 | 3300003432 | Wetland | DGPLKTADEIEALLIQELRQLGRTTMHQWATQAEERVSAELQAQDATVRGLKKKR* |
JGI20214J51088_105442582 | 3300003432 | Wetland | ADEVEELLIQELRQLGHTSLCQWATQAEARVSNELKGQDPTIRSRKKKR* |
Ga0055485_100465122 | 3300004067 | Natural And Restored Wetlands | YNTEGPLKSAGQVEELLIQEMRRLGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR* |
Ga0055512_101272651 | 3300004072 | Natural And Restored Wetlands | ELLIQELRALGSTSMNDFATQAEARVGDELKGRDATVRSRKKKR* |
Ga0062380_105424632 | 3300004779 | Wetland Sediment | LAITRNAAGPLPTADAVEALLIEEMRQLGHATLSQWAIQAEARVGTELQRLDPTVRSRKKKR* |
Ga0070710_102965352 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DEVEELLIQEMRQLGNRSMSQWARHAEERVSKELKEQDPTVRSRKKKR* |
Ga0070708_1017629221 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IQEMRQLGHATMSEWATQAEVRVSEELRSQDPSVLSRKKKR* |
Ga0070697_1020807462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VEELLIQEMRRLGHLTLSQWAIQAEERVSTELKSQDPTVRSRKKKR* |
Ga0070686_1018231731 | 3300005544 | Switchgrass Rhizosphere | RRLGNATMNQWAAQAEGRVGQELKGQDPTIRNRKKKR*RGGVSLD* |
Ga0074471_101035031 | 3300005831 | Sediment (Intertidal) | LIEALRQLGHESMNQWAAQAEQRVSTELQQQDATVRRRKKKR* |
Ga0070766_108346982 | 3300005921 | Soil | DEVEELLIQEMRQLGRTTLQHWATQAEERVSTELQSQDPTVRSRKKKR* |
Ga0066651_105433592 | 3300006031 | Soil | EVEELLIQEMRQLGNRSMSQWARHAEERVSKELKEQDPTVRSRKKKR* |
Ga0075026_1006608332 | 3300006057 | Watersheds | QNAEGPLKSADEVEGLLIQEMRQLGNTSMREWIGQSEERVSKELREQNPTVRSRKKKR* |
Ga0079222_112833772 | 3300006755 | Agricultural Soil | RRLGHSTMSQWATGAEERLSTELQNQDPTVLSRKKKR* |
Ga0079220_111694672 | 3300006806 | Agricultural Soil | VEELLIEEMRQLGNSSMSQWATHAEERVSQELKEQDPTVRSRKKKR* |
Ga0075425_1006987362 | 3300006854 | Populus Rhizosphere | CLGNTTMNRWAVQAQERVGQELKEQDPSIRSRKKKH* |
Ga0075429_1012457141 | 3300006880 | Populus Rhizosphere | LKTADEVEELLIQEMRQLGNTSMHQWATHAEERVSQELKEQDPSVRSRKKKR* |
Ga0068865_1021187031 | 3300006881 | Miscanthus Rhizosphere | GPLKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH* |
Ga0073928_102718203 | 3300006893 | Iron-Sulfur Acid Spring | LLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR* |
Ga0105105_105278191 | 3300009009 | Freshwater Sediment | SADEVEELLIQEMRRLGNTSMQQWATQAEQRVSRELKAQDGTVRSRKKKR* |
Ga0066709_1008577171 | 3300009137 | Grasslands Soil | ELLIQEVRRLGNITMNQWAAQAEERVGQELKEQDPAIGNRKKKH* |
Ga0111538_132247202 | 3300009156 | Populus Rhizosphere | LKTADEVEEFLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR* |
Ga0114970_106652901 | 3300009163 | Freshwater Lake | EIEALLIQELRQLGSTTMHQWATQAEERVSAELQAQDATVRGLKKKR* |
Ga0113563_134262362 | 3300009167 | Freshwater Wetlands | DEVEELLIQEVRRLGSATMHQWAVGAEERVSTELKSQDPTVRSRKKKR* |
Ga0113563_137298151 | 3300009167 | Freshwater Wetlands | VEELLIQELRRLGSTTMHQWASQAEARVSTELQQEDPTVLSRKKKR* |
Ga0114940_103287432 | 3300009448 | Groundwater | LIQELRQLGRTTLHQWAAQAEARVSAELQAGDATVRGLKKKR* |
Ga0114942_12816251 | 3300009527 | Groundwater | PLKSADEVEWLLIQELRQLGHSTMTEWATEAEARVGDELQRQDATVRSRKKKR* |
Ga0074045_101247201 | 3300010341 | Bog Forest Soil | DQIEELLIQEMRLLGNTSMHQWATQAEERVSRELKSQDATVRSRKKKR* |
Ga0074044_106103002 | 3300010343 | Bog Forest Soil | MRRLGGATLHHWARQAEERVGAELRRQDPTVRSRKKKR* |
Ga0116236_101697723 | 3300010353 | Anaerobic Digestor Sludge | VRQLGHTTMSQWAQGAEERVSQELRGEDATVRSRKKKR* |
Ga0105239_133354972 | 3300010375 | Corn Rhizosphere | ELLIKAMRQLGNETMGQWASQAEERVSRELKEQDPTVLARKKKR* |
Ga0134127_105241402 | 3300010399 | Terrestrial Soil | LKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH* |
Ga0134127_130356731 | 3300010399 | Terrestrial Soil | LGQTTMSQWATQAEERVSTELKSQDPTVLSRKKKR* |
Ga0134122_103313321 | 3300010400 | Terrestrial Soil | RLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH* |
Ga0134123_103634492 | 3300010403 | Terrestrial Soil | VEELLIEEMRRLGQTTMTQWAAQAEERVSTELKSQDPTVLSRKKKH* |
Ga0134123_131408281 | 3300010403 | Terrestrial Soil | GPLKTADEEEALLIQEMRRWGNATMNKWASGAEERVSTELKEEDSTIRSRKKKR* |
Ga0137442_10349411 | 3300011414 | Soil | ADEVEELLIEEMRRLGNVTLSRWAIQAEERVSTELKSEDPTVRSQKKRR* |
Ga0137436_11784662 | 3300011423 | Soil | QELRQLGRSTMNQWATQAEVRVGAELKSQDATVRRLKKKR* |
Ga0137432_10490951 | 3300011439 | Soil | LLIQEMRRVGNAAMNQWAVQAEERVGTELKEEDPTLRPRKKKR* |
Ga0137445_11054371 | 3300012035 | Soil | DLAHAAEGPLKTADEIESLLIQELRQLGSTTMNQWATQAEERVSAELQAQDATVRGLKKKR* |
Ga0150985_1081220972 | 3300012212 | Avena Fatua Rhizosphere | EEMRQLGQVTMTEWAAEAEARVATELQRQDPTVLSRKKKR* |
Ga0137404_109686242 | 3300012929 | Vadose Zone Soil | EELLIQEMRLLGRATMSEWATQAEVRVSDELRSQDPTVLSRKKKR* |
Ga0137404_111501911 | 3300012929 | Vadose Zone Soil | NTEGPLKTADEVEELLIQEMRQLGNTSMGQWATHAEERVSKELKQQDPSVRSRKKKR* |
Ga0137410_101895071 | 3300012944 | Vadose Zone Soil | EEMRRLGQTTMSQWAAQVEERVSTELKSQDPTVLSRKKKH* |
Ga0134110_106321921 | 3300012975 | Grasslands Soil | ELRLLGNTSLCQWATQAEARVSDELKGQDPTIRSRKKKR* |
Ga0181523_107283192 | 3300014165 | Bog | AYDAEGPLKSADQVEELLIQEMRRLGNTSMHQWAAQAEQRVSRELKAQDGTVRSRKKKR* |
Ga0075348_12234301 | 3300014319 | Natural And Restored Wetlands | DIAYNTEGPLKSADQVEELLIQEMRRLVNTSMHQWATQAEQLVSRELKAQDGTVRSRKKKR* |
Ga0182010_104264911 | 3300014490 | Fen | TADQVEKLLIQEIRQLGHATMSQWAAQAEQRVSTELKEQDPTVRSRKKKR* |
Ga0182024_117909371 | 3300014501 | Permafrost | QEMRQLGSATLHHWAAQAEERVSAELQQQDPTVSSRKKKR* |
Ga0180060_10466722 | 3300014863 | Soil | ELRQLGSTTMHQWARQAEERVSGELKGLDPTVRSRKKKR* |
Ga0180080_10835621 | 3300014870 | Soil | LAIMSNAEGPLKSADEVEGLLIQEIRRLGNTTMNQWAARAEERAGQDLKAEDPTVRSRKKKR* |
Ga0137403_108261981 | 3300015264 | Vadose Zone Soil | VEELLIQEMRLLGRATMSEWATQAEVRVSDELRSQDPTVLSRKKKR* |
Ga0134069_11455682 | 3300017654 | Grasslands Soil | EVEGLLIQEMRRLGKTTMNQWASQAEERVVQELKEQDPTIRSRKKKR |
Ga0184637_103249051 | 3300018063 | Groundwater Sediment | VEELLIQEMRRVGNAAMNQWAVQAEERVGTELKEKDPTLRPRKKKR |
Ga0184628_106441702 | 3300018083 | Groundwater Sediment | EGQLIEALRQLGHESMNQWAARAEQRVSTELQQRDATVRSRKKKR |
Ga0193713_12034241 | 3300019882 | Soil | ADEVEELLIQELRQLGNASMNQWATQAEQRVSTELKSQDATVRSRKKKR |
Ga0193710_10064641 | 3300019998 | Soil | RWGNVALSQWASQAEERVSTELKRQDSTVRSRKKKR |
Ga0193718_10885272 | 3300019999 | Soil | LLVDEMRRLGHSTMKHWATHAEEQVSTELQQQDPTVLSRKKKR |
Ga0210377_101538102 | 3300021090 | Groundwater Sediment | LIQQLRQLGHTTMNQWATQAEERVSAELQAQDATVRGLKKKR |
Ga0193699_100730842 | 3300021363 | Soil | LELTRNANGPLKSADEVEGLLIQELRQLGNTSMAEWATQAEDRVSNELKGLDATVRSRKKKH |
Ga0210386_114120672 | 3300021406 | Soil | LIQEMRQLGNSSMSQWATHAEERVSKELKEQDPSVRSRKKKR |
Ga0194053_100575223 | 3300021520 | Anoxic Zone Freshwater | MYKFSHLPADEVEELLIQELRRLGHTSMTQWAQQAEARVSDELTRQDPT |
Ga0247676_10705672 | 3300024249 | Soil | LGNSSMSQWATHAEERVSQELKEQDPSVRSRKKKR |
Ga0247678_10867382 | 3300024325 | Soil | QLGNSSMSQWAMHAEERVSKELKEQDPTLRSRKKKR |
(restricted) Ga0255046_101268321 | 3300024519 | Seawater | LLIQELRRLGNTTLCQWATQAEARVSNELKDQDPTIRSRKKKH |
Ga0207653_100541443 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RCLGNTTMNRWAVQAQERVGQELKEQDPSIRSRKKKR |
Ga0207693_108672682 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QLGNSSMGQWATHAEERVSEELKAQDPSVRSRKKKR |
Ga0207709_106959501 | 3300025935 | Miscanthus Rhizosphere | LKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH |
Ga0256820_10133321 | 3300026486 | Sediment | VEELLIQEMRRLGSTTMHQWANQAEERVTTELRRQDPTVLSRKKKR |
Ga0256806_10270972 | 3300026501 | Sediment | GPLKSADQVEELLIQEMRRLGNTSMHQWATQAEQRVSRELKAGDGTVRSRKKKR |
Ga0208365_10298262 | 3300027070 | Forest Soil | EELLIQEMRQLGNSSMSQWAAHAEERVSKELKEQDPTVRSRKKKR |
Ga0208685_11333552 | 3300027513 | Soil | MRQLGNVTLSQWAIQAEERVSTELKSQDPTVRSRKKKR |
Ga0209797_104460192 | 3300027831 | Wetland Sediment | LAITRNAAGPLPTADAVEALLIEEMRQLGHATLSQWAIQAEARVGTELQRLDPTVRSRKKKR |
Ga0209450_111189761 | 3300027885 | Freshwater Lake Sediment | LGNTSMNDFATQAEERVGDELKGRDATVRSRKKKR |
Ga0265351_10258792 | 3300028020 | Soil | MRQLGNATLTGWAIQAEERVSAELKSQDPSVRRRKKKG |
Ga0268265_103280333 | 3300028380 | Switchgrass Rhizosphere | NQEGPLKTADEVEEKLIEEVRQLGHCTMTQWAGIAEQRVSTELRSKDPTVVSRKKKR |
Ga0268265_108716961 | 3300028380 | Switchgrass Rhizosphere | LLIQEMRQLGHATMSEWATQAEVRVSEELRSQDPSVLSRKKKR |
Ga0265337_10572441 | 3300028556 | Rhizosphere | GPLKTADEVEELLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR |
Ga0311347_107412022 | 3300029923 | Fen | LGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR |
Ga0311336_103834942 | 3300029990 | Fen | IAYNAEGPLKSADQVEELLIQEMRRLGNTSMQQWATQAEQRVSRELKAQDATVRSRKKKR |
Ga0302286_102294812 | 3300030047 | Fen | NTEGPLKSADQVEELLVQEMRRLGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR |
Ga0311349_105245331 | 3300030294 | Fen | EELLVDEMRRLGSITMTQWATQAEERVSTELRSQDSTVLSRKKKR |
Ga0311349_112355951 | 3300030294 | Fen | NAEGPLKSADEVEALLIQEVRQLGNATMRQWATQAEERVGNEVKAQDATIRSRKKKR |
Ga0302323_1011633381 | 3300031232 | Fen | ADAVEALLIQELRRLGSATMHQWASQAEARVTTELQQQDPTVLSRKKKR |
Ga0302324_1011518972 | 3300031236 | Palsa | LKTADEVEALLIEEMRQLGRTTLHQWAIQAEERVSQELKSQDPTVRSRKKKD |
Ga0302326_106331423 | 3300031525 | Palsa | RKLGSATIHHWAAEAEERVCAELRQQDPTVLSRKKKR |
Ga0265314_101880621 | 3300031711 | Rhizosphere | LKTADEIEGLLIEEMRQLGNTTLGAWAIQAEERVSRELKSQDSTVRSRKKKR |
Ga0307474_102920281 | 3300031718 | Hardwood Forest Soil | TADEVEELLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR |
Ga0302321_1018795172 | 3300031726 | Fen | LIQELRRLGNTTLCQWATQAEARVSNELKGQDPTLRSRKKKR |
Ga0308176_116245912 | 3300031996 | Soil | LGNETMCQWASQAEERVSRELKEQDPTVLSRKKKR |
Ga0315278_112898222 | 3300031997 | Sediment | EGLLIQEMRQLGNTSMVEWATQAEERVSNELKGLDATVRSRKKKR |
Ga0315277_113070472 | 3300032118 | Sediment | LRRLGNTTLCQWATQAEARVSNELKGQDPTIRSRKKKR |
Ga0315292_106750042 | 3300032143 | Sediment | VEALLIQELRQLGNSSMNHWATQAEERVSEELKGQDASVRSRKKKR |
Ga0315281_108634112 | 3300032163 | Sediment | IEEMRQLGNTTLCEWATQAEERVSGELRSQDPTVLSRKKKH |
Ga0315283_111878092 | 3300032164 | Sediment | ELLIQEMRRLGSTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR |
Ga0315283_113065122 | 3300032164 | Sediment | VEGLLIQEMRQLGNTSMREWIGQSEERVSKELKEQNPTVRSRKKKR |
Ga0315271_102880422 | 3300032256 | Sediment | TADAVEEQLIEALRQLGHESMNQWAAQAEQRVSTELQQQEATVRSRKKKR |
Ga0315271_111327841 | 3300032256 | Sediment | ELLIEKLRQLGNVSMNQWAQQAEARVSQELKAADDTVRSRKKKR |
Ga0315271_113163862 | 3300032256 | Sediment | LRQLGNSSMNQWATQAEQRVSDELKAEDATVRSRKKKR |
Ga0315271_117451941 | 3300032256 | Sediment | PLKTADQVEELVIEEMRRLGNVTLSQWAIEAEERVSTELRSQDPTVRSRKKKR |
Ga0315270_111389122 | 3300032275 | Sediment | GATTGPLKSADEVEALLIQELRQLGNRSMSQWAAHAEERVSKELKEQDPTVRSRKKKR |
Ga0335069_111441472 | 3300032893 | Soil | AYNTEGPLKSADQVEELLIQEMRRLGSTSMHQWATQAEQRVSRELKAGDGTVRSRKKKH |
Ga0310810_107875382 | 3300033412 | Soil | TADEVEELLIEEMRQLGNSSMSQWATHAEERVSQELKEQDPTVRSRKKKR |
Ga0316625_1007428891 | 3300033418 | Soil | GPLKTADEVEELLIEQMRQLGNETMGQWASQAEERVSRELKEQDPTVLSRKKKH |
Ga0316629_112600752 | 3300033483 | Soil | VEEQLIETLRQLGHESMNEWAARAEQRVGTELQQQDATVRRRKKKR |
Ga0370501_0105897_3_134 | 3300034195 | Untreated Peat Soil | LLIKELRRLGNTTLCQWAKQAEAHVSNELKAQDPTIRSRKKKH |
Ga0372943_1184090_20_136 | 3300034268 | Soil | MRQLGNSSMSQWATRAEERVSKELREQDPTVRSRKKKR |
⦗Top⦘ |