NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088689

Metagenome Family F088689

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088689
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 47 residues
Representative Sequence LLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR
Number of Associated Samples 98
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 4.11 %
% of genes near scaffold ends (potentially truncated) 64.22 %
% of genes from short scaffolds (< 2000 bps) 66.97 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (67.890 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(10.092 % of family members)
Environment Ontology (ENVO) Unclassified
(22.936 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(23.853 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 54.93%    β-sheet: 0.00%    Coil/Unstructured: 45.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF06782UPF0236 14.68
PF00483NTP_transferase 0.92
PF14331IcmF-related_N 0.92
PF04055Radical_SAM 0.92
PF00005ABC_tran 0.92
PF13472Lipase_GDSL_2 0.92



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A67.89 %
All OrganismsrootAll Organisms32.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003432|JGI20214J51088_10252888All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus1222Open in IMG/M
3300003432|JGI20214J51088_10544258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus740Open in IMG/M
3300004067|Ga0055485_10046512Not Available968Open in IMG/M
3300004779|Ga0062380_10542463All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005437|Ga0070710_10296535All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300005445|Ga0070708_101762922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium575Open in IMG/M
3300005536|Ga0070697_102080746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium508Open in IMG/M
3300005831|Ga0074471_10103503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium573Open in IMG/M
3300005921|Ga0070766_10834698All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006031|Ga0066651_10543359All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300006057|Ga0075026_100660833All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300006755|Ga0079222_11283377All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium665Open in IMG/M
3300006806|Ga0079220_11169467All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300006880|Ga0075429_101245714All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006881|Ga0068865_102118703All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006893|Ga0073928_10271820All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300009009|Ga0105105_10527819All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium679Open in IMG/M
3300009156|Ga0111538_13224720Not Available568Open in IMG/M
3300009167|Ga0113563_13426236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium537Open in IMG/M
3300009167|Ga0113563_13729815Not Available516Open in IMG/M
3300009527|Ga0114942_1281625All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300010341|Ga0074045_10124720Not Available1766Open in IMG/M
3300010375|Ga0105239_13335497Not Available522Open in IMG/M
3300010399|Ga0134127_10524140Not Available1201Open in IMG/M
3300010403|Ga0134123_10363449Not Available1312Open in IMG/M
3300010403|Ga0134123_13140828Not Available531Open in IMG/M
3300011414|Ga0137442_1034941Not Available962Open in IMG/M
3300011439|Ga0137432_1049095Not Available1269Open in IMG/M
3300012035|Ga0137445_1105437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium572Open in IMG/M
3300012212|Ga0150985_108122097All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium652Open in IMG/M
3300012929|Ga0137404_10968624Not Available778Open in IMG/M
3300012929|Ga0137404_11150191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium713Open in IMG/M
3300014165|Ga0181523_10728319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium541Open in IMG/M
3300014319|Ga0075348_1223430Not Available529Open in IMG/M
3300014490|Ga0182010_10426491All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium726Open in IMG/M
3300014870|Ga0180080_1083562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium558Open in IMG/M
3300015264|Ga0137403_10826198Not Available780Open in IMG/M
3300017654|Ga0134069_1145568Not Available790Open in IMG/M
3300018063|Ga0184637_10324905Not Available929Open in IMG/M
3300018083|Ga0184628_10644170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium532Open in IMG/M
3300019882|Ga0193713_1203424Not Available504Open in IMG/M
3300019999|Ga0193718_1088527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300021363|Ga0193699_10073084Not Available1356Open in IMG/M
3300021520|Ga0194053_10057522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1695Open in IMG/M
3300025935|Ga0207709_10695950Not Available813Open in IMG/M
3300026486|Ga0256820_1013332Not Available1100Open in IMG/M
3300026501|Ga0256806_1027097Not Available994Open in IMG/M
3300027070|Ga0208365_1029826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium717Open in IMG/M
3300027831|Ga0209797_10446019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium520Open in IMG/M
3300028380|Ga0268265_10328033Not Available1389Open in IMG/M
3300028380|Ga0268265_10871696Not Available882Open in IMG/M
3300028556|Ga0265337_1057244Not Available1085Open in IMG/M
3300029990|Ga0311336_10383494Not Available1176Open in IMG/M
3300030047|Ga0302286_10229481Not Available935Open in IMG/M
3300030294|Ga0311349_10524533Not Available1120Open in IMG/M
3300030294|Ga0311349_11235595All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium697Open in IMG/M
3300031232|Ga0302323_101163338Not Available861Open in IMG/M
3300031236|Ga0302324_101151897Not Available1038Open in IMG/M
3300031525|Ga0302326_10633142All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300031711|Ga0265314_10188062Not Available1231Open in IMG/M
3300031718|Ga0307474_10292028Not Available1255Open in IMG/M
3300031997|Ga0315278_11289822All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium712Open in IMG/M
3300032143|Ga0315292_10675004Not Available869Open in IMG/M
3300032163|Ga0315281_10863411Not Available928Open in IMG/M
3300032164|Ga0315283_11187809Not Available797Open in IMG/M
3300032164|Ga0315283_11306512Not Available752Open in IMG/M
3300032256|Ga0315271_10288042Not Available1347Open in IMG/M
3300032256|Ga0315271_11745194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium534Open in IMG/M
3300032275|Ga0315270_11138912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium519Open in IMG/M
3300032893|Ga0335069_11144147Not Available855Open in IMG/M
3300033412|Ga0310810_10787538Not Available862Open in IMG/M
3300033418|Ga0316625_100742889Not Available831Open in IMG/M
3300033483|Ga0316629_11260075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium593Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment10.09%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.42%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.83%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.83%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.83%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.83%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.83%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.83%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.92%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.92%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.92%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090005Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004072Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009448Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek SourceEnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014863Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026486Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6EnvironmentalOpen in IMG/M
3300026501Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LWSO_075574502088090005Freshwater SedimentRLILELRQLGNSSMNQWATQAEERVSAELKGQDATVRSRKKKR
deepsgr_002424502199352025SoilLIHELRQLGSTTMNQWAVQAEERVSAELQAQDVTVRGLXXXR
JGI20214J51088_1025288813300003432WetlandDGPLKTADEIEALLIQELRQLGRTTMHQWATQAEERVSAELQAQDATVRGLKKKR*
JGI20214J51088_1054425823300003432WetlandADEVEELLIQELRQLGHTSLCQWATQAEARVSNELKGQDPTIRSRKKKR*
Ga0055485_1004651223300004067Natural And Restored WetlandsYNTEGPLKSAGQVEELLIQEMRRLGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR*
Ga0055512_1012726513300004072Natural And Restored WetlandsELLIQELRALGSTSMNDFATQAEARVGDELKGRDATVRSRKKKR*
Ga0062380_1054246323300004779Wetland SedimentLAITRNAAGPLPTADAVEALLIEEMRQLGHATLSQWAIQAEARVGTELQRLDPTVRSRKKKR*
Ga0070710_1029653523300005437Corn, Switchgrass And Miscanthus RhizosphereDEVEELLIQEMRQLGNRSMSQWARHAEERVSKELKEQDPTVRSRKKKR*
Ga0070708_10176292213300005445Corn, Switchgrass And Miscanthus RhizosphereIQEMRQLGHATMSEWATQAEVRVSEELRSQDPSVLSRKKKR*
Ga0070697_10208074623300005536Corn, Switchgrass And Miscanthus RhizosphereVEELLIQEMRRLGHLTLSQWAIQAEERVSTELKSQDPTVRSRKKKR*
Ga0070686_10182317313300005544Switchgrass RhizosphereRRLGNATMNQWAAQAEGRVGQELKGQDPTIRNRKKKR*RGGVSLD*
Ga0074471_1010350313300005831Sediment (Intertidal)LIEALRQLGHESMNQWAAQAEQRVSTELQQQDATVRRRKKKR*
Ga0070766_1083469823300005921SoilDEVEELLIQEMRQLGRTTLQHWATQAEERVSTELQSQDPTVRSRKKKR*
Ga0066651_1054335923300006031SoilEVEELLIQEMRQLGNRSMSQWARHAEERVSKELKEQDPTVRSRKKKR*
Ga0075026_10066083323300006057WatershedsQNAEGPLKSADEVEGLLIQEMRQLGNTSMREWIGQSEERVSKELREQNPTVRSRKKKR*
Ga0079222_1128337723300006755Agricultural SoilRRLGHSTMSQWATGAEERLSTELQNQDPTVLSRKKKR*
Ga0079220_1116946723300006806Agricultural SoilVEELLIEEMRQLGNSSMSQWATHAEERVSQELKEQDPTVRSRKKKR*
Ga0075425_10069873623300006854Populus RhizosphereCLGNTTMNRWAVQAQERVGQELKEQDPSIRSRKKKH*
Ga0075429_10124571413300006880Populus RhizosphereLKTADEVEELLIQEMRQLGNTSMHQWATHAEERVSQELKEQDPSVRSRKKKR*
Ga0068865_10211870313300006881Miscanthus RhizosphereGPLKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH*
Ga0073928_1027182033300006893Iron-Sulfur Acid SpringLLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR*
Ga0105105_1052781913300009009Freshwater SedimentSADEVEELLIQEMRRLGNTSMQQWATQAEQRVSRELKAQDGTVRSRKKKR*
Ga0066709_10085771713300009137Grasslands SoilELLIQEVRRLGNITMNQWAAQAEERVGQELKEQDPAIGNRKKKH*
Ga0111538_1322472023300009156Populus RhizosphereLKTADEVEEFLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR*
Ga0114970_1066529013300009163Freshwater LakeEIEALLIQELRQLGSTTMHQWATQAEERVSAELQAQDATVRGLKKKR*
Ga0113563_1342623623300009167Freshwater WetlandsDEVEELLIQEVRRLGSATMHQWAVGAEERVSTELKSQDPTVRSRKKKR*
Ga0113563_1372981513300009167Freshwater WetlandsVEELLIQELRRLGSTTMHQWASQAEARVSTELQQEDPTVLSRKKKR*
Ga0114940_1032874323300009448GroundwaterLIQELRQLGRTTLHQWAAQAEARVSAELQAGDATVRGLKKKR*
Ga0114942_128162513300009527GroundwaterPLKSADEVEWLLIQELRQLGHSTMTEWATEAEARVGDELQRQDATVRSRKKKR*
Ga0074045_1012472013300010341Bog Forest SoilDQIEELLIQEMRLLGNTSMHQWATQAEERVSRELKSQDATVRSRKKKR*
Ga0074044_1061030023300010343Bog Forest SoilMRRLGGATLHHWARQAEERVGAELRRQDPTVRSRKKKR*
Ga0116236_1016977233300010353Anaerobic Digestor SludgeVRQLGHTTMSQWAQGAEERVSQELRGEDATVRSRKKKR*
Ga0105239_1333549723300010375Corn RhizosphereELLIKAMRQLGNETMGQWASQAEERVSRELKEQDPTVLARKKKR*
Ga0134127_1052414023300010399Terrestrial SoilLKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH*
Ga0134127_1303567313300010399Terrestrial SoilLGQTTMSQWATQAEERVSTELKSQDPTVLSRKKKR*
Ga0134122_1033133213300010400Terrestrial SoilRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH*
Ga0134123_1036344923300010403Terrestrial SoilVEELLIEEMRRLGQTTMTQWAAQAEERVSTELKSQDPTVLSRKKKH*
Ga0134123_1314082813300010403Terrestrial SoilGPLKTADEEEALLIQEMRRWGNATMNKWASGAEERVSTELKEEDSTIRSRKKKR*
Ga0137442_103494113300011414SoilADEVEELLIEEMRRLGNVTLSRWAIQAEERVSTELKSEDPTVRSQKKRR*
Ga0137436_117846623300011423SoilQELRQLGRSTMNQWATQAEVRVGAELKSQDATVRRLKKKR*
Ga0137432_104909513300011439SoilLLIQEMRRVGNAAMNQWAVQAEERVGTELKEEDPTLRPRKKKR*
Ga0137445_110543713300012035SoilDLAHAAEGPLKTADEIESLLIQELRQLGSTTMNQWATQAEERVSAELQAQDATVRGLKKKR*
Ga0150985_10812209723300012212Avena Fatua RhizosphereEEMRQLGQVTMTEWAAEAEARVATELQRQDPTVLSRKKKR*
Ga0137404_1096862423300012929Vadose Zone SoilEELLIQEMRLLGRATMSEWATQAEVRVSDELRSQDPTVLSRKKKR*
Ga0137404_1115019113300012929Vadose Zone SoilNTEGPLKTADEVEELLIQEMRQLGNTSMGQWATHAEERVSKELKQQDPSVRSRKKKR*
Ga0137410_1018950713300012944Vadose Zone SoilEEMRRLGQTTMSQWAAQVEERVSTELKSQDPTVLSRKKKH*
Ga0134110_1063219213300012975Grasslands SoilELRLLGNTSLCQWATQAEARVSDELKGQDPTIRSRKKKR*
Ga0181523_1072831923300014165BogAYDAEGPLKSADQVEELLIQEMRRLGNTSMHQWAAQAEQRVSRELKAQDGTVRSRKKKR*
Ga0075348_122343013300014319Natural And Restored WetlandsDIAYNTEGPLKSADQVEELLIQEMRRLVNTSMHQWATQAEQLVSRELKAQDGTVRSRKKKR*
Ga0182010_1042649113300014490FenTADQVEKLLIQEIRQLGHATMSQWAAQAEQRVSTELKEQDPTVRSRKKKR*
Ga0182024_1179093713300014501PermafrostQEMRQLGSATLHHWAAQAEERVSAELQQQDPTVSSRKKKR*
Ga0180060_104667223300014863SoilELRQLGSTTMHQWARQAEERVSGELKGLDPTVRSRKKKR*
Ga0180080_108356213300014870SoilLAIMSNAEGPLKSADEVEGLLIQEIRRLGNTTMNQWAARAEERAGQDLKAEDPTVRSRKKKR*
Ga0137403_1082619813300015264Vadose Zone SoilVEELLIQEMRLLGRATMSEWATQAEVRVSDELRSQDPTVLSRKKKR*
Ga0134069_114556823300017654Grasslands SoilEVEGLLIQEMRRLGKTTMNQWASQAEERVVQELKEQDPTIRSRKKKR
Ga0184637_1032490513300018063Groundwater SedimentVEELLIQEMRRVGNAAMNQWAVQAEERVGTELKEKDPTLRPRKKKR
Ga0184628_1064417023300018083Groundwater SedimentEGQLIEALRQLGHESMNQWAARAEQRVSTELQQRDATVRSRKKKR
Ga0193713_120342413300019882SoilADEVEELLIQELRQLGNASMNQWATQAEQRVSTELKSQDATVRSRKKKR
Ga0193710_100646413300019998SoilRWGNVALSQWASQAEERVSTELKRQDSTVRSRKKKR
Ga0193718_108852723300019999SoilLLVDEMRRLGHSTMKHWATHAEEQVSTELQQQDPTVLSRKKKR
Ga0210377_1015381023300021090Groundwater SedimentLIQQLRQLGHTTMNQWATQAEERVSAELQAQDATVRGLKKKR
Ga0193699_1007308423300021363SoilLELTRNANGPLKSADEVEGLLIQELRQLGNTSMAEWATQAEDRVSNELKGLDATVRSRKKKH
Ga0210386_1141206723300021406SoilLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPSVRSRKKKR
Ga0194053_1005752233300021520Anoxic Zone FreshwaterMYKFSHLPADEVEELLIQELRRLGHTSMTQWAQQAEARVSDELTRQDPT
Ga0247676_107056723300024249SoilLGNSSMSQWATHAEERVSQELKEQDPSVRSRKKKR
Ga0247678_108673823300024325SoilQLGNSSMSQWAMHAEERVSKELKEQDPTLRSRKKKR
(restricted) Ga0255046_1012683213300024519SeawaterLLIQELRRLGNTTLCQWATQAEARVSNELKDQDPTIRSRKKKH
Ga0207653_1005414433300025885Corn, Switchgrass And Miscanthus RhizosphereRCLGNTTMNRWAVQAQERVGQELKEQDPSIRSRKKKR
Ga0207693_1086726823300025915Corn, Switchgrass And Miscanthus RhizosphereQLGNSSMGQWATHAEERVSEELKAQDPSVRSRKKKR
Ga0207709_1069595013300025935Miscanthus RhizosphereLKSADEVEELLIEEMRRLGNVTLRQWAIQAEERVSNELKSQDPTVRSRKKKH
Ga0256820_101333213300026486SedimentVEELLIQEMRRLGSTTMHQWANQAEERVTTELRRQDPTVLSRKKKR
Ga0256806_102709723300026501SedimentGPLKSADQVEELLIQEMRRLGNTSMHQWATQAEQRVSRELKAGDGTVRSRKKKR
Ga0208365_102982623300027070Forest SoilEELLIQEMRQLGNSSMSQWAAHAEERVSKELKEQDPTVRSRKKKR
Ga0208685_113335523300027513SoilMRQLGNVTLSQWAIQAEERVSTELKSQDPTVRSRKKKR
Ga0209797_1044601923300027831Wetland SedimentLAITRNAAGPLPTADAVEALLIEEMRQLGHATLSQWAIQAEARVGTELQRLDPTVRSRKKKR
Ga0209450_1111897613300027885Freshwater Lake SedimentLGNTSMNDFATQAEERVGDELKGRDATVRSRKKKR
Ga0265351_102587923300028020SoilMRQLGNATLTGWAIQAEERVSAELKSQDPSVRRRKKKG
Ga0268265_1032803333300028380Switchgrass RhizosphereNQEGPLKTADEVEEKLIEEVRQLGHCTMTQWAGIAEQRVSTELRSKDPTVVSRKKKR
Ga0268265_1087169613300028380Switchgrass RhizosphereLLIQEMRQLGHATMSEWATQAEVRVSEELRSQDPSVLSRKKKR
Ga0265337_105724413300028556RhizosphereGPLKTADEVEELLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR
Ga0311347_1074120223300029923FenLGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR
Ga0311336_1038349423300029990FenIAYNAEGPLKSADQVEELLIQEMRRLGNTSMQQWATQAEQRVSRELKAQDATVRSRKKKR
Ga0302286_1022948123300030047FenNTEGPLKSADQVEELLVQEMRRLGNTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR
Ga0311349_1052453313300030294FenEELLVDEMRRLGSITMTQWATQAEERVSTELRSQDSTVLSRKKKR
Ga0311349_1123559513300030294FenNAEGPLKSADEVEALLIQEVRQLGNATMRQWATQAEERVGNEVKAQDATIRSRKKKR
Ga0302323_10116333813300031232FenADAVEALLIQELRRLGSATMHQWASQAEARVTTELQQQDPTVLSRKKKR
Ga0302324_10115189723300031236PalsaLKTADEVEALLIEEMRQLGRTTLHQWAIQAEERVSQELKSQDPTVRSRKKKD
Ga0302326_1063314233300031525PalsaRKLGSATIHHWAAEAEERVCAELRQQDPTVLSRKKKR
Ga0265314_1018806213300031711RhizosphereLKTADEIEGLLIEEMRQLGNTTLGAWAIQAEERVSRELKSQDSTVRSRKKKR
Ga0307474_1029202813300031718Hardwood Forest SoilTADEVEELLIQEMRQLGNSSMSQWATHAEERVSKELKEQDPTVRSRKKKR
Ga0302321_10187951723300031726FenLIQELRRLGNTTLCQWATQAEARVSNELKGQDPTLRSRKKKR
Ga0308176_1162459123300031996SoilLGNETMCQWASQAEERVSRELKEQDPTVLSRKKKR
Ga0315278_1128982223300031997SedimentEGLLIQEMRQLGNTSMVEWATQAEERVSNELKGLDATVRSRKKKR
Ga0315277_1130704723300032118SedimentLRRLGNTTLCQWATQAEARVSNELKGQDPTIRSRKKKR
Ga0315292_1067500423300032143SedimentVEALLIQELRQLGNSSMNHWATQAEERVSEELKGQDASVRSRKKKR
Ga0315281_1086341123300032163SedimentIEEMRQLGNTTLCEWATQAEERVSGELRSQDPTVLSRKKKH
Ga0315283_1118780923300032164SedimentELLIQEMRRLGSTSMHQWATQAEQRVSRELKAQDGTVRSRKKKR
Ga0315283_1130651223300032164SedimentVEGLLIQEMRQLGNTSMREWIGQSEERVSKELKEQNPTVRSRKKKR
Ga0315271_1028804223300032256SedimentTADAVEEQLIEALRQLGHESMNQWAAQAEQRVSTELQQQEATVRSRKKKR
Ga0315271_1113278413300032256SedimentELLIEKLRQLGNVSMNQWAQQAEARVSQELKAADDTVRSRKKKR
Ga0315271_1131638623300032256SedimentLRQLGNSSMNQWATQAEQRVSDELKAEDATVRSRKKKR
Ga0315271_1174519413300032256SedimentPLKTADQVEELVIEEMRRLGNVTLSQWAIEAEERVSTELRSQDPTVRSRKKKR
Ga0315270_1113891223300032275SedimentGATTGPLKSADEVEALLIQELRQLGNRSMSQWAAHAEERVSKELKEQDPTVRSRKKKR
Ga0335069_1114414723300032893SoilAYNTEGPLKSADQVEELLIQEMRRLGSTSMHQWATQAEQRVSRELKAGDGTVRSRKKKH
Ga0310810_1078753823300033412SoilTADEVEELLIEEMRQLGNSSMSQWATHAEERVSQELKEQDPTVRSRKKKR
Ga0316625_10074288913300033418SoilGPLKTADEVEELLIEQMRQLGNETMGQWASQAEERVSRELKEQDPTVLSRKKKH
Ga0316629_1126007523300033483SoilVEEQLIETLRQLGHESMNEWAARAEQRVGTELQQQDATVRRRKKKR
Ga0370501_0105897_3_1343300034195Untreated Peat SoilLLIKELRRLGNTTLCQWAKQAEAHVSNELKAQDPTIRSRKKKH
Ga0372943_1184090_20_1363300034268SoilMRQLGNSSMSQWATRAEERVSKELREQDPTVRSRKKKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.