NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088655

Metagenome Family F088655

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088655
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 41 residues
Representative Sequence AYAPDSHRGQKMYVRGLLIKLPDEQRLTISAFETLSPTCGG
Number of Associated Samples 96
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.02 %
% of genes near scaffold ends (potentially truncated) 88.07 %
% of genes from short scaffolds (< 2000 bps) 86.24 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.991 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(11.009 % of family members)
Environment Ontology (ENVO) Unclassified
(28.440 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.376 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.80%    β-sheet: 34.78%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF13442Cytochrome_CBB3 17.43
PF13620CarboxypepD_reg 2.75
PF04227Indigoidine_A 1.83
PF02784Orn_Arg_deC_N 1.83
PF04191PEMT 1.83
PF00278Orn_DAP_Arg_deC 0.92
PF13414TPR_11 0.92
PF01202SKI 0.92
PF00158Sigma54_activat 0.92
PF00392GntR 0.92
PF02167Cytochrom_C1 0.92
PF00593TonB_dep_Rec 0.92
PF028262-Hacid_dh_C 0.92
PF07676PD40 0.92
PF13493DUF4118 0.92
PF01850PIN 0.92
PF04140ICMT 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 2.75
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 2.75
COG2313Pseudouridine-5'-phosphate glycosidase (pseudoU degradation)Nucleotide transport and metabolism [F] 1.83
COG2857Cytochrome c1Energy production and conversion [C] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.99 %
UnclassifiedrootN/A11.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_102866022All Organisms → cellular organisms → Bacteria2430Open in IMG/M
3300001977|JGI24746J21847_1023402All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300002568|C688J35102_118857074All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300005093|Ga0062594_100699939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300005093|Ga0062594_101199491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300005184|Ga0066671_10878039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005340|Ga0070689_101084274All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium715Open in IMG/M
3300005340|Ga0070689_101464333All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300005343|Ga0070687_100511434All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300005456|Ga0070678_101623960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300005459|Ga0068867_100448138All Organisms → cellular organisms → Bacteria → Acidobacteria1099Open in IMG/M
3300005467|Ga0070706_100251751All Organisms → cellular organisms → Bacteria → Acidobacteria1649Open in IMG/M
3300005518|Ga0070699_100638222All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300005526|Ga0073909_10124759All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300005526|Ga0073909_10704531All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300005536|Ga0070697_101695612All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300005543|Ga0070672_101808536All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300005615|Ga0070702_100344348All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300005617|Ga0068859_101993599All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300005719|Ga0068861_100184454All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300005843|Ga0068860_101941496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300006058|Ga0075432_10550849All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300006791|Ga0066653_10299846All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006797|Ga0066659_10844911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300006844|Ga0075428_100037835All Organisms → cellular organisms → Bacteria5310Open in IMG/M
3300006871|Ga0075434_100676688All Organisms → cellular organisms → Bacteria → Acidobacteria1050Open in IMG/M
3300006871|Ga0075434_101349432All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300006880|Ga0075429_101005404All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300006904|Ga0075424_100013977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8077Open in IMG/M
3300007076|Ga0075435_100138486All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300007255|Ga0099791_10142829All Organisms → cellular organisms → Bacteria → Acidobacteria1116Open in IMG/M
3300009011|Ga0105251_10158094All Organisms → cellular organisms → Bacteria → Acidobacteria1022Open in IMG/M
3300009147|Ga0114129_12516388All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300009162|Ga0075423_11219905All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300009162|Ga0075423_11749186All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium670Open in IMG/M
3300009553|Ga0105249_11891454All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300010362|Ga0126377_12671206All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300010362|Ga0126377_12721989All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300010373|Ga0134128_13124837All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300010397|Ga0134124_12241669All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300011119|Ga0105246_10843051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300012355|Ga0137369_11081333All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300012922|Ga0137394_10893383All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300012929|Ga0137404_11019153All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300012957|Ga0164303_10097343All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300012976|Ga0134076_10271628All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300012985|Ga0164308_11348697All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300013296|Ga0157374_12162240All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300013308|Ga0157375_11620490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300014878|Ga0180065_1107226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300014969|Ga0157376_11538568All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300015360|Ga0163144_10294947All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300015371|Ga0132258_12666006All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300015371|Ga0132258_13533247All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300015374|Ga0132255_100590088All Organisms → cellular organisms → Bacteria → Acidobacteria1642Open in IMG/M
3300016270|Ga0182036_11686810All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300016371|Ga0182034_12067387Not Available503Open in IMG/M
3300017695|Ga0180121_10391554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300018000|Ga0184604_10098365All Organisms → cellular organisms → Bacteria → Acidobacteria902Open in IMG/M
3300018078|Ga0184612_10458163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300018429|Ga0190272_12251769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300018468|Ga0066662_10717362All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300018476|Ga0190274_11340649All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300021080|Ga0210382_10057401All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300021082|Ga0210380_10182078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300024055|Ga0247794_10162614All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300025922|Ga0207646_10261304All Organisms → cellular organisms → Bacteria → Acidobacteria1564Open in IMG/M
3300025925|Ga0207650_11434773All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300025936|Ga0207670_11297730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300025940|Ga0207691_11385682All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300025940|Ga0207691_11680230All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300026118|Ga0207675_100831800All Organisms → cellular organisms → Bacteria → Acidobacteria938Open in IMG/M
3300026274|Ga0209888_1077606All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300026297|Ga0209237_1121196All Organisms → cellular organisms → Bacteria → Acidobacteria1099Open in IMG/M
3300026298|Ga0209236_1298996All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300026542|Ga0209805_1227474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300026550|Ga0209474_10443317All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300027875|Ga0209283_10401430All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium893Open in IMG/M
3300027886|Ga0209486_10870109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300027903|Ga0209488_11005803All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300027907|Ga0207428_11274151All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300028381|Ga0268264_10720897All Organisms → cellular organisms → Bacteria → Acidobacteria992Open in IMG/M
3300028381|Ga0268264_11562024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300028802|Ga0307503_10751125All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300031199|Ga0307495_10044384All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300031228|Ga0299914_10672198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300031716|Ga0310813_10152465All Organisms → cellular organisms → Bacteria1861Open in IMG/M
3300031716|Ga0310813_10644455All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300031748|Ga0318492_10262450All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300031764|Ga0318535_10115653Not Available1182Open in IMG/M
3300031764|Ga0318535_10426968All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300031879|Ga0306919_10277136All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300031908|Ga0310900_10139790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1622Open in IMG/M
3300031943|Ga0310885_10070938All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300031947|Ga0310909_10968267All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300032075|Ga0310890_11031224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300032179|Ga0310889_10228682All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300032275|Ga0315270_10803154All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300033289|Ga0310914_10914291All Organisms → cellular organisms → Bacteria777Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.34%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.75%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.83%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.92%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.92%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.92%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026274Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10286602243300000956SoilALKGRKMYVKGLLIRLPGEQRMTISSFETVAPTCGS*
JGI24746J21847_102340223300001977Corn, Switchgrass And Miscanthus RhizosphereYPAAAHRDHKMYLRGLLIKLPDEQRLTISAFEMLSPGCGR*
C688J35102_11885707423300002568SoilYAPDEHKGHKVYVRGLLVKLPDEQRMTISAFEMVSATCGD*
Ga0062594_10069993913300005093SoilLDAMAYGPESHKGHKMYVRGLLIRLPSEQRMTISSFEMIAPSCSN*
Ga0062594_10119949113300005093SoilLDAMAYDPQSHKGEKMYVRGLLIRLPGEQRMTISSIDSIAPSCQ*
Ga0066671_1087803913300005184SoilLLDAMAYAPDAHKGHKMYVRGLLIKIPGEQRMTISAFEMISPACSE*
Ga0070689_10108427413300005340Switchgrass RhizosphereMAYTPMSHKGQRMYVRGMLIKVATEQRITISAFETVAPACAQ*
Ga0070689_10146433323300005340Switchgrass RhizosphereAIAYSPADHRGQKIYVRGLLIKLPGEQRLTISALETLSPTCGN*
Ga0070687_10051143413300005343Switchgrass RhizosphereAPDAHKSQKVYVRGLLIRLPGEQRMTISALETVSPSCREP*
Ga0070678_10162396013300005456Miscanthus RhizosphereSPDAHKGHKMSVRGLLVKLPDEQRMTISSITMVAPACSE*
Ga0068867_10044813823300005459Miscanthus RhizosphereRLLDAIAYSPADHRGQKIYVRGLLIKLPGEQRLTISAFETLSRTCGN*
Ga0070706_10025175123300005467Corn, Switchgrass And Miscanthus RhizosphereAMAYAPDDHKGHKMYVRGLLIKLPDEQRMTISALEMVSRVCSD*
Ga0070699_10063822213300005518Corn, Switchgrass And Miscanthus RhizosphereAYAPDSHRGQKMYVRGLLIKLPDEQRLTISAFETLSPTCGG*
Ga0073909_1012475913300005526Surface SoilRGHKMYLRGLLIKLPDEQRLTISAFEMLSPGCGR*
Ga0073909_1070453123300005526Surface SoilSPADHRGQKIYVRGLLIKLPGEQRLTISAFETLSPTCGN*
Ga0070697_10169561223300005536Corn, Switchgrass And Miscanthus RhizosphereDALAYAPDNHKGQTIYVRGLLIKAGSEPRMTISALETVAPTCRDR*
Ga0070672_10180853613300005543Miscanthus RhizosphereLLDAMAYAPDDHRGQTIYVRGLLIKQAGEPRLTISALETVSPTCRD*
Ga0070702_10034434823300005615Corn, Switchgrass And Miscanthus RhizosphereAYSPADHRGQKIYVRGLLIKLPGEQRLTISAFETLSRTCGN*
Ga0068859_10199359913300005617Switchgrass RhizosphereHKSQKVYVRGLLIKLPGEQRLTISALETVSPSCREP*
Ga0066905_10076671123300005713Tropical Forest SoilAPETHKGQKIYVRGLLIRLPGVQRITISALETVSPSCTE*
Ga0068861_10018445413300005719Switchgrass RhizospherePQSHKGEKMYVRGLLIRLPGEQRMTISSIDSIAPSCQ*
Ga0068860_10194149623300005843Switchgrass RhizosphereLVDAIAYAPDAHAGQKVHVRGLLIRLPGEQRMTISALETVSPTCRE*
Ga0075432_1055084913300006058Populus RhizosphereLLDAIAYSPADHRGQKMYVRGLLIKLPGEQRLTISAFETLSPTCGDTTK*
Ga0066653_1029984613300006791SoilAAHKGQKMYLRGLLIRLADEQRMTISALETVSPSCSE*
Ga0066659_1084491113300006797SoilMAYAPETHRGQKIFVRGLLIKLPDEQRIAISAFEMLSPSCSE*
Ga0075428_10003783513300006844Populus RhizosphereLAYAADAHIGHKMYVRGLLIKLSNEQRITISAFETLSPACSN*
Ga0075434_10067668813300006871Populus RhizosphereRGQKMYVRGLLIKLPGEQRLTISAFETLSPTCGN*
Ga0075434_10134943213300006871Populus RhizosphereFHLLDAIAYAPEGHRGQKMYVRGLLIKLPDEQRITISAFEMVSPTCSN*
Ga0075429_10100540423300006880Populus RhizosphereGLAYAADAHIGHKMYVRGLLIKLSNEQRITISAFEMLSPTCTN*
Ga0075424_10001397763300006904Populus RhizosphereRGQKMYVRGLLIKLPGEQRLTISAFETLSPTCGDTTK*
Ga0075435_10013848613300007076Populus RhizosphereYAPELHKGQKMYVRGLLIKASGEQRLTISAFETLSPTCNE*
Ga0075435_10166092123300007076Populus RhizosphereTHVGQKLYVRGLLIRLGGEQRITISTLEPLSARCAE*
Ga0099791_1014282913300007255Vadose Zone SoilDHAGHKMHVRGLLIRLPGEQRMTISAFEMVSPTCSD*
Ga0105251_1015809413300009011Switchgrass RhizosphereMAYAPDAHKSQKVYVRGLLIKLPGEQRMTISALETVSAN*
Ga0114129_1251638813300009147Populus RhizosphereAMAYAPDDHKGHTIYVRGLLIKLAGEPRMTISAFEMVSPTCR*
Ga0075423_1121990513300009162Populus RhizosphereMAYAPEAHSGHTMYVRGLLIKLPGDERLTISAFEMVSPSCRD*
Ga0075423_1174918623300009162Populus RhizosphereDAHIGHKMYVRGLLIRLSSEQRLTISAFETLSPTCTD*
Ga0105249_1189145423300009553Switchgrass RhizosphereAYAPDQHIGHKMYVRGLLIKLPGDERVTISAFEMVSPTCRE*
Ga0126377_1267120623300010362Tropical Forest SoilMAYTPDAHRGHKMHLRGLLINLPGEQRMTISSLDMVSAVCE*
Ga0126377_1272198923300010362Tropical Forest SoilMAYAPDAHTGHKMYIRGLLIKLPDEQRMTISAFEMVSPTCPD*
Ga0134128_1312483713300010373Terrestrial SoilAIAYSPADHRGQKIYVRGLLIKLPGEQRLTISAFETLSRTCGN*
Ga0134124_1224166923300010397Terrestrial SoilYPAAAHRDHKMYLRGLLIKLPGEQRLTISAFEMLSPGCGR*
Ga0126383_1111607913300010398Tropical Forest SoilSHKGQKIYVRGLLIRMPGEQRITISALETMSPTCAE*
Ga0105246_1084305123300011119Miscanthus RhizosphereAPDAHRGHKMYARGLLIKLPDETRLTISLLEMLAPSCAE*
Ga0137369_1108133313300012355Vadose Zone SoilDAMAYAPDSRRGQKMYVRGLLIKLPTEQRLTISAFESLSPTCGG*
Ga0150984_10117006023300012469Avena Fatua RhizosphereALAYAPQTHVGHKLYVRGLLIRLPGEQRITISALEPLATRCAE*
Ga0150984_11908049523300012469Avena Fatua RhizosphereVGHKLYVRGLLIRLPGEQRITISALEPLSSRCAE*
Ga0137394_1089338313300012922Vadose Zone SoilDAMAYAPDSHRGQKMYVRGLLIKLPDEQRITISAFETISTTCSN*
Ga0137404_1101915323300012929Vadose Zone SoilRTFHLLDALAYAPDDHKAQRIYVRGLLIALPGEERLTISAFETVSPSCRE*
Ga0164303_1009734313300012957SoilHRGQKIYVRGLLIKLPGEQRLTISAFETLSPTCGN*
Ga0134076_1027162833300012976Grasslands SoilSDKGHKIYVRGLVIKLPDEQRLTISVFESVSPTCGE*
Ga0164308_1134869723300012985SoilSPADHRGQKIYVRGLLIKLPGEQRLTISAFESLSPTCGN*
Ga0157374_1216224013300013296Miscanthus RhizosphereDAMAYAPDAHKSQKVYVRGLLIKLPGEQRMTISALETVSANCREQ*
Ga0157375_1162049013300013308Miscanthus RhizosphereLLDAMAYAPDDRKGQTVYVRGLLIKLAGEPRMTISTFETVSPTCRD*
Ga0180065_110722613300014878SoilGPQSYKGHKMYVRGLLIKLPSEQRMTISSFETVAPTCTN*
Ga0157376_1153856813300014969Miscanthus RhizosphereDSHRGQKVYVRGLMIKLPGEQRMAISTLEIVSPSCID*
Ga0163144_1029494713300015360Freshwater Microbial MatRLLDAMAYSPESHKGHKMYVRGLLIRIPGEQRMTISAFETVAPTCSH*
Ga0132258_1266600633300015371Arabidopsis RhizosphereGTYHLVDAIAYTPDQHKGQKMYVRGLLIKLADEQRMTISALEMVSPTCSE*
Ga0132258_1353324713300015371Arabidopsis RhizosphereEQHAGQTMSVRGLLITLPGEQRMAISSFEMVQPGCRE*
Ga0132255_10059008833300015374Arabidopsis RhizosphereLDAIAYSPADHRGQKMYVRGLLIKLPGEQRLTISAFETLSPTCGN*
Ga0182036_1168681023300016270SoilLLDAAAYNADAHTGQKVYVRGLLIKLPDEQRMTISAFEPVSLTCQ
Ga0182032_1085130513300016357SoilQHNGQKVYVRGLLLRVPGEQRMTISAMEMLSQTCSD
Ga0182034_1206738713300016371SoilLIDAIAYAPEAHSGHKMYVRGLLVRLAGEPRLTISVFETVSPTCSD
Ga0180121_1039155413300017695Polar Desert SandNPEAHRGHKMYVRGLLIKLPSEQRMTISSFETLAPNCAN
Ga0184604_1009836533300018000Groundwater SedimentDAMAYAPDGHKNHKMYVRGLLIKLPGEQRMTISAFEMVSPTCSD
Ga0184612_1045816313300018078Groundwater SedimentDHQGHKMYVRGLLIKVPDGPRMTISAFEMVSATCSE
Ga0190272_1225176913300018429SoilMAYSPESHKGHKMYVRGLLIKIPGEQRMTISALETVGQSCSQ
Ga0066662_1071736223300018468Grasslands SoilHKGHKMYVRGLLIKLPGDERITISAFEMVSPTCGE
Ga0190274_1134064923300018476SoilPGDHKGHTMYVRGLLIKLPAEQRITISAFEMVSPTCTK
Ga0210382_1005740113300021080Groundwater SedimentMAYAPDGHIGHKVYVRGLLIKLPGDERLTISAFEMVSPTCRD
Ga0210380_1018207813300021082Groundwater SedimentAMAYNPDSLKGKKMYVKGLLIRLPGEQRMTISALETVAPTCVN
Ga0247794_1016261413300024055SoilAMAYSPDAHKGHKMSVRGLLVKLPDEQRMTISSITMVAPACSE
Ga0207649_1096898023300025920Corn RhizosphereEHKGQKVFVRGLLLKVPGEQRMTISALEPLSQTCSD
Ga0207646_1026130423300025922Corn, Switchgrass And Miscanthus RhizosphereYGPESHKGHKMYVRGLLIRLPSEQRMTISSFEMIAPSCSN
Ga0207650_1143477323300025925Switchgrass RhizosphereKSQKVYVRGLLIKLPGEQRMTISALETVSPSCREP
Ga0207670_1129773023300025936Switchgrass RhizosphereSPDAHKGHKMSVRGLLVKLPDEQRMTISSITMVAPACSE
Ga0207691_1138568223300025940Miscanthus RhizosphereLLDAMAYAPDDHRGQTIYVRGLLIKQAGEPRLTISALETVSPTCRD
Ga0207691_1168023023300025940Miscanthus RhizosphereAYAPDAHKSQKVYVRGLLIRLPGEQRMTISALETVSPSCREP
Ga0207648_1223336723300026089Miscanthus RhizosphereQTHVGQKLYVRGLLIRLGGEQRITISTLEPLSARCAE
Ga0207675_10083180023300026118Switchgrass RhizosphereDHKGHTMYVRGLLIKLPAEQRITISAFEMVSPTCQR
Ga0209888_107760613300026274Permafrost SoilDDHRSQKVYVRGLLIKLPGEQRMTISALEMVSPTCRE
Ga0209237_112119623300026297Grasslands SoilFHLLDAMAYAPDDHRGHKMYVRGLLIKLADEQRMTISAFEMVAPTCND
Ga0209236_129899623300026298Grasslands SoilDDHRGHKMYVRGLLIKLADEQRMTISAFEMVSPTCSD
Ga0209805_122747423300026542SoilDAMAYAPETHRGQKIFVRGLLIKLPDEQRIAISAFEMLSPSCSE
Ga0209474_1044331713300026550SoilDAMAYAPQDHAGHKMYVRGLLIKLPGEQRMTISAFEMVSPACSE
Ga0209283_1040143023300027875Vadose Zone SoilAIAYAPDAHRGHKMYVRGLLINLPDEQRMTISAFEIVSLICSE
Ga0209486_1087010913300027886Agricultural SoilLDAMAYNPEQHKGKKMYVKGLLIRLPGEQRMTISSFETIAPSCMN
Ga0209488_1100580323300027903Vadose Zone SoilLVDAVAYAPDNHAGHKMYIRGLLIRLPGEQRMTISAFEMVSPTCSD
Ga0207428_1127415123300027907Populus RhizosphereIAYSPADHRGQKMYVRGLLIKLPGEQRLTISAFETLSPTCGDTTK
Ga0268264_1072089723300028381Switchgrass RhizosphereDAMAYAPDDRKGQTIYVRGLLIKLAGEPRMTISTFETVSPTCRD
Ga0268264_1156202413300028381Switchgrass RhizosphereQTYALVDAIAYAPDAHAGQKVHVRGLLIRLPGEQRMTISALETVSPTCRE
Ga0307517_1055950323300028786EctomycorrhizaPGEHKGQKVSIRGLLIRVPGEQRMTISALETLSPDCRE
Ga0307503_1075112513300028802SoilMAYAPDAHKSQKVYVRGLLIRLPGEQRMTISALETVSPSCREP
Ga0307495_1004438423300031199SoilIRLVDAMAYAPDAHNGHTMHVRGLLITLPGEQRMTISTFEMVRPSCHE
Ga0299914_1067219823300031228SoilYSPQSLKGHKMYVKGLLIKLPGEQRMTISSLETIAPSCN
Ga0310813_1015246513300031716SoilFAYAPDAHRGQKIYVRGLLIRLADGPRMTISAFETVSPTCE
Ga0310813_1064445513300031716SoilYSPADHRGQKIYVRGLLIKLPGEQRLTISAFETLSPTCGN
Ga0318492_1026245023300031748SoilAMAYAPEAHNGHKMYVRGLLVKLASEARLTISVFEMVSPSCSD
Ga0318535_1011565323300031764SoilAHNGHKMYVRGLLVKLASEARLTISVFEMVSPSCSD
Ga0318535_1042696823300031764SoilVYLVDAMAYAPQQHNGQKVYVRGLLLRVPGEQRMTISAMEMLSQTCSD
Ga0318567_1076228823300031821SoilQQHNGQKVYVRGLLLRVPGEQRMTISAMEMLSQTCSD
Ga0306919_1027713633300031879SoilHLLDAAAYNADAHTGQKVYVRGLLIKLPDEQRMTISAFEPVLPTCR
Ga0310900_1013979033300031908SoilMAYPAAAHRGHKMYLRGLLIKLPDEQRLTISAFEMRSPGCGR
Ga0310885_1007093813300031943SoilSHKGHKMYVKGLLIKIPGEQRMTISAFEMLAPSCQ
Ga0310909_1096826723300031947SoilLVDAMAYAPQQHNGQKVYVRGLLLRVPGEQRMTISAMEMLSQTCSD
Ga0310890_1103122413300032075SoilAHKGHKMSVRGLLVKLPDEQRMTISSITMVAPACSE
Ga0310889_1022868223300032179SoilHLLDAMAYPAAAHRGHKMYLRGLLIKLPDEQRLTISAFEMRSPGCGR
Ga0315270_1080315413300032275SedimentYAPDDHKNQKMYVRGLLIKLTGEQRLTISALDMVSPTCRE
Ga0310914_1091429133300033289SoilAAAYNADAHTGQKVYVRGLLIKLPDEQRMTISAFEPVSLTCQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.