NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087916

Metagenome Family F087916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087916
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 55 residues
Representative Sequence LRTRLARGGVAAARRTSWDRVTDVQEEIYREVASRTAATKLSTDPS
Number of Associated Samples 89
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(32.727 % of family members)
Environment Ontology (ENVO) Unclassified
(36.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(62.727 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.76%    β-sheet: 0.00%    Coil/Unstructured: 43.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00534Glycos_transf_1 70.00
PF13579Glyco_trans_4_4 16.36
PF00535Glycos_transf_2 3.64
PF04014MazE_antitoxin 1.82
PF13439Glyco_transf_4 1.82
PF02604PhdYeFM_antitox 0.91
PF00092VWA 0.91
PF00801PKD 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.91
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105792632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1700Open in IMG/M
3300000956|JGI10216J12902_108014093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300000956|JGI10216J12902_111539760All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300001431|F14TB_101701292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300002568|C688J35102_118664588All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300004479|Ga0062595_100738274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300004479|Ga0062595_101225050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300004479|Ga0062595_101885399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300004643|Ga0062591_100680843All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300005093|Ga0062594_101382921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300005176|Ga0066679_10707388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300005177|Ga0066690_10590623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300005178|Ga0066688_10964413All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005335|Ga0070666_11006289All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005355|Ga0070671_101096423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300005364|Ga0070673_100557789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1041Open in IMG/M
3300005456|Ga0070678_101746329All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005467|Ga0070706_102091551All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005468|Ga0070707_101454153All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005547|Ga0070693_100398394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium954Open in IMG/M
3300005552|Ga0066701_10317029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium967Open in IMG/M
3300005559|Ga0066700_11175255All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005561|Ga0066699_11080792All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005568|Ga0066703_10425620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300005587|Ga0066654_10408083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300005614|Ga0068856_100827502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria945Open in IMG/M
3300005719|Ga0068861_101858871All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006032|Ga0066696_10409630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium885Open in IMG/M
3300006791|Ga0066653_10407447All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300006871|Ga0075434_102179768All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300006903|Ga0075426_11244111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300006954|Ga0079219_11263860All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300006954|Ga0079219_12489569All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009012|Ga0066710_103103574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300009012|Ga0066710_103441309All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300010401|Ga0134121_12794559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300012353|Ga0137367_10663281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300012987|Ga0164307_10226108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1291Open in IMG/M
3300013766|Ga0120181_1111107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300015245|Ga0137409_11429264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300017654|Ga0134069_1151008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300018027|Ga0184605_10002613All Organisms → cellular organisms → Bacteria6102Open in IMG/M
3300018054|Ga0184621_10204787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300018061|Ga0184619_10200277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria917Open in IMG/M
3300018061|Ga0184619_10327431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300018071|Ga0184618_10313573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300018071|Ga0184618_10402683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300018075|Ga0184632_10005165All Organisms → cellular organisms → Bacteria5458Open in IMG/M
3300018433|Ga0066667_11208763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300018433|Ga0066667_11668184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300019886|Ga0193727_1030321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1858Open in IMG/M
3300021073|Ga0210378_10254464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300021080|Ga0210382_10190335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300021344|Ga0193719_10237040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300021415|Ga0193694_1038745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300025901|Ga0207688_10536712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300025916|Ga0207663_10656460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium828Open in IMG/M
3300025917|Ga0207660_11645298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300025922|Ga0207646_11224694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300025927|Ga0207687_11458572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300025932|Ga0207690_10953072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300025941|Ga0207711_10292044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1503Open in IMG/M
3300025960|Ga0207651_10949573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300026035|Ga0207703_11718780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300026296|Ga0209235_1278145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300026298|Ga0209236_1170007All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300026536|Ga0209058_1333522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300026542|Ga0209805_1438455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300026550|Ga0209474_10149007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1526Open in IMG/M
3300028587|Ga0247828_10352004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300028711|Ga0307293_10241603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300028715|Ga0307313_10053081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1190Open in IMG/M
3300028715|Ga0307313_10072277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1031Open in IMG/M
3300028715|Ga0307313_10128916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300028719|Ga0307301_10079321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300028720|Ga0307317_10320030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300028722|Ga0307319_10017293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2202Open in IMG/M
3300028722|Ga0307319_10211306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300028784|Ga0307282_10519323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300028784|Ga0307282_10666550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300028787|Ga0307323_10000565All Organisms → cellular organisms → Bacteria11413Open in IMG/M
3300028787|Ga0307323_10128236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300028793|Ga0307299_10166604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium829Open in IMG/M
3300028793|Ga0307299_10277469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300028796|Ga0307287_10051085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1519Open in IMG/M
3300028807|Ga0307305_10015725All Organisms → cellular organisms → Bacteria3368Open in IMG/M
3300028807|Ga0307305_10233966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300028807|Ga0307305_10520589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300028810|Ga0307294_10155066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300028811|Ga0307292_10019457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2382Open in IMG/M
3300028819|Ga0307296_10011639All Organisms → cellular organisms → Bacteria4627Open in IMG/M
3300028819|Ga0307296_10030633All Organisms → cellular organisms → Bacteria → Proteobacteria2837Open in IMG/M
3300028819|Ga0307296_10494608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300028819|Ga0307296_10781343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300028828|Ga0307312_10040862All Organisms → cellular organisms → Bacteria2739Open in IMG/M
3300028828|Ga0307312_11132832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300028872|Ga0307314_10017029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1627Open in IMG/M
3300028875|Ga0307289_10227096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300028878|Ga0307278_10290692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300028880|Ga0307300_10042847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300028881|Ga0307277_10206188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300028884|Ga0307308_10631130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300028889|Ga0247827_10887996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300031740|Ga0307468_100638687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300031740|Ga0307468_101195493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300031902|Ga0302322_100112117All Organisms → cellular organisms → Bacteria2857Open in IMG/M
3300031997|Ga0315278_10807947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300032002|Ga0307416_103744984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300032005|Ga0307411_11564880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300034268|Ga0372943_0524326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil32.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10579263213300000364SoilERRAVVEAIRCVLSDPTLREQLARGGPAAARRMSWDTVTDVQERIYTDVAARNASTDAS*
JGI10216J12902_10801409323300000956SoilSDDDLRARLARGGPVAARRTSWDRVADMQEQIYKDVAARNASTDAS*
JGI10216J12902_11153976013300000956SoilAAIRRVLSDSALREQLARGGVEAARRTSWDRVADVQEQIYRAVASRTAATKFSTDGS*
F14TB_10170129213300001431SoilFFAEGEALVVPYEREAVVAAIGRVLADDALRAQLARGGPEAARRMSWDHVAHVQEEIYCSVASRTASTNESTDGP*
C688J35102_11866458823300002568SoilFFEDGEALVVPYDGAAVIGAVRQVLGDGALRERLSLGGVAAARRMSWDSVAAAQEEIYRAAASRTAATKLSTEGS*
Ga0062595_10073827413300004479SoilARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS*
Ga0062595_10122505013300004479SoilLSAGGLAAARRMSWDPVTEAQERIYRAAASRTARTNDSTDGS*
Ga0062595_10188539913300004479SoilREQLARGGPAAARRMSWDAVTDVQERIYTDVAARNASTDAS*
Ga0062591_10068084313300004643SoilRSVLSDATLRERLARGGVAAARRTSWDRVADLQEELYRAAASRTAATKLSTEGS*
Ga0062594_10138292123300005093SoilVVPYEGAAVVDAVRQVLSDESLRSSLAQGGRAAAKRASWDHVTDLQEEIYRDVASRTAATKLSTDGS*
Ga0066679_1070738823300005176SoilTRLARGGVAAARRTSWDRVTDVQEEIYREVASRTAATKLSTDPS*
Ga0066690_1059062323300005177SoilPELRARLARGGIAAARRTSWDHVTDLQEEIYREVASRTAETTFSTDGS*
Ga0066688_1096441313300005178SoilVLSDDGLRARLARGGFEAARRTSWDRVTDRQEEIYRVVASRTAAAKLSTDGS*
Ga0070666_1100628913300005335Switchgrass RhizosphereAAIVEAVRNVLVDPELQARLARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS*
Ga0070671_10109642313300005355Switchgrass RhizosphereVVPYEGAAVVDAVRQVLSDERLRSSLAQGGRAAAKRASWDHVTDLQEEIYRDVASRTAATKLSTDGS*
Ga0070673_10055778923300005364Switchgrass RhizospherePYEGAAVVDAVRQVLSDESLRSSLAQGGRAAAKRASWDHVTDLQEEIYREVASRTAATKLSTDGS*
Ga0070678_10174632923300005456Miscanthus RhizosphereEAVRNVLVDPELQARLARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS*
Ga0070706_10209155123300005467Corn, Switchgrass And Miscanthus RhizosphereAVVDAVRRVLSDQALREQLAHGGLEAARRTSWDLVTDAQEEIYGAVASRTASTKPSTEGS
Ga0070707_10145415323300005468Corn, Switchgrass And Miscanthus RhizosphereKREEIVTAVRRVLTDAALRERLARGGVTAALRNSWDHVADIQEAIYREVASRTASRKFSTDGS*
Ga0070693_10039839413300005547Corn, Switchgrass And Miscanthus RhizosphereQARLARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS*
Ga0066701_1031702923300005552SoilLAQGGIDAARRTSWDHVTDVQEEIYREAASRTAATKSSTDGS*
Ga0066700_1117525523300005559SoilAVRRVVTDRDLRDRLSRGGVEATRRNSWDHVTDVQEEIYRAIASHTAATKLSTEGS*
Ga0066699_1108079213300005561SoilLRERLARGGLEAAHRMSWDRVTDRQEAIYRDVLASRTAATKFSTEVS*
Ga0066703_1042562023300005568SoilLRTRLARGGVAAARRTSWDRVTDVQEEIYREVASRTAATKLSTDPS*
Ga0066654_1040808313300005587SoilEQLREQLARGGPSAARRMSWDRVADLQEEIYRAVASRTAATKFSTETL*
Ga0068856_10082750213300005614Corn RhizosphereTDDDLRERLARGGPAAARRTSWDRVTDTQERLYSEIAARKASTEAS*
Ga0068861_10185887113300005719Switchgrass RhizosphereIRRVLTDDDLRAQLARGGPVAARRTSWDRVADAQEEIYRAVASRTAATNASTDAS*
Ga0066696_1040963013300006032SoilARGALEAARRTSWDDVTDRQEAIYRAIASRTAATKLSTDES*
Ga0066653_1040744713300006791SoilTSFQDGEALVVPYDRDAIVAAVQRVLADEELRVRLARGGIAAAKRTSWDRVTDVQEEIYREAAAITAL*
Ga0075434_10217976813300006871Populus RhizospherePALRERLASGGVAAARRTSWDHVTDAQERIYRDVASRTAATKFSTDGS*
Ga0075426_1124411113300006903Populus RhizospherePEAARRNSWNRVTDLQEEIYRAVASRTAATKFSTDGS*
Ga0079219_1126386023300006954Agricultural SoilYEREAVVTAIRRVLSDSELRARLARGGPAAARRTSWDHVTDLQERIYADVATRKASTDAS
Ga0079219_1248956923300006954Agricultural SoilVLADETLRERLSAGGIAAARRNSWDRVADVQEEIYRAAASRTAATKLSTDGS*
Ga0066710_10310357413300009012Grasslands SoilTSFQDGEALVVPYDRDAIVAAVQRVLADEELRVRLARGGIAAAKRTSWDRVTDLQEEIYREAAAITAL
Ga0066710_10344130933300009012Grasslands SoilVPYEREAVVDAVRRVVSDPELRARLARGGIEAARRTSWDRVTDRQEQIYRAVTASR
Ga0134121_1279455923300010401Terrestrial SoilFFHDGEALVVPYESAAVINAVRQVLEDPEVRDRLARGGVAAAKRTSWDHVTDLQEEIYRAAAARTAAAKRSTDGS*
Ga0137367_1066328123300012353Vadose Zone SoilCGIAGFFQDGEALIVPYERTAVVEAVRNVLTDPRLHAQLARGGIAAARRTSWDRVTDVQEKIYREVASRTAATKLSTDDS*
Ga0164307_1022610813300012987SoilKVVVPYESAAVINAVRLVLEDPEVRDRLARGGVAAAKRTSWDHVTDVQEEIYRAAAARTAAAKRSTDGS*
Ga0120181_111110713300013766PermafrostVPYEQAAVVEAVGSVLADPDLRARLARGGIAAARRTSWDHVTDVQEEIYREVASRTAATKLSTDDS*
Ga0137409_1142926423300015245Vadose Zone SoilGIAAARRTSWDHVTDLQEQIYRDVASRTAATKLSTDGS*
Ga0134069_115100833300017654Grasslands SoilDGEALVVPYDRDAIVAAVQRVLADEELRVRLARGGIAAAKRTSWDRVTDLQEEIYREAAAITAL
Ga0184605_1000261373300018027Groundwater SedimentVAAARRTSWDRVTDVQEGIYREVASRTAATKLSTDDS
Ga0184621_1020478713300018054Groundwater SedimentPAAARRMSWDHVTEAQERIYRAVASRTAATKLSTDGS
Ga0184619_1020027723300018061Groundwater SedimentAQGGPAAARRMSWDHVTDAQERIYRAVASRTAATKLSTDGS
Ga0184619_1032743123300018061Groundwater SedimentAAVVEAVGSVLADPELRARLERGGIAAARRTSWDRVTDVQEEIYREVASRTAATKLSTED
Ga0184618_1031357323300018071Groundwater SedimentAVQRVLSDDELRARLARGGIEAARRTSWDAVTDRQEAIYREIASRTAATKLSTDGA
Ga0184618_1040268323300018071Groundwater SedimentFQDGEALIVPYERAAVVEAIRSALADPDLRARLARGGVVAARRMSWDHVTDTQEQIYREVASRTAATKLSTDGS
Ga0184632_1000516563300018075Groundwater SedimentDGLRARLARGGVAAARRTSWDHVTDLQEEIYRDVASRTAARKLSTDAS
Ga0066667_1120876313300018433Grasslands SoilESDLRGRLAGGGTEAARRNSWDHVADLQEEIYRAVASRTAATKFSTDGA
Ga0066667_1166818423300018433Grasslands SoilRVLADPDLRARLARGGIEAARRTSWDRVTDAQEEIYRAAASRTAATKLSTDGS
Ga0193727_103032113300019886SoilGEALVVPYDGAAVIGAVRQVLGDGGLRERLAQGGVAAAKRMSWDSVAAAQEEIYRAAASRTAATKLSTEGS
Ga0210378_1025446423300021073Groundwater SedimentLARGGVAAARRTSWDHVTDLQEEIYRDVASRTAARKLSTDGS
Ga0210382_1019033513300021080Groundwater SedimentPELRERLARGGIAAARRTSWDRVTDIQEEIYREVASRTAATKLSTDDS
Ga0193719_1023704023300021344SoilQVLSDVRLRSSLAQGGRAAAKRASWDHVTDLQEEIYREVASRTAATKLSTDGS
Ga0193694_103874523300021415SoilVPYEREAVVEAVRRVLSDEQLRERLGRGGVAAARRTSWDHVTDVQEEIYRDVAARTAVTKLSTDES
Ga0207688_1053671223300025901Corn, Switchgrass And Miscanthus RhizosphereGFFGDGEALVVPYDGAAVIGAVRQVLCNGDLRERLAQGGVAAARRMSWDSVAATQEEIYRAAASRTAATKLSTEGS
Ga0207663_1065646013300025916Corn, Switchgrass And Miscanthus RhizosphereARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS
Ga0207660_1164529823300025917Corn RhizospherePYERTAIVEAVRKVLVDPELQARLARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS
Ga0207646_1122469423300025922Corn, Switchgrass And Miscanthus RhizosphereKREEIVTAVRRVLTDAALRERLARGGVTAALRNSWDHVADIQEAIYREVASRTASRKFSTDGS
Ga0207687_1145857223300025927Miscanthus RhizosphereLVNPELQARLARGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS
Ga0207690_1095307223300025932Corn RhizosphereIAGFFGDGEALVVPYDGAAVIGAVRQVLCNGDLRERLAQGGVAAARRMSWDSVAATQEEIYRAAASRTAATKLSTEGS
Ga0207711_1029204423300025941Switchgrass RhizosphereDAVRSVLSDATLRERLALGGVAAARRTSWDRVADLQEEIYRAAASTAATKLSTEGS
Ga0207651_1094957313300025960Switchgrass RhizosphereAAVVDAVRSVLSDATLRERLALGGVAAARRTSWDRVADMQEEIYRAAASTAATKLSTEGS
Ga0207703_1171878023300026035Switchgrass RhizosphereGGIAAARRNSWDRVTDVQEEIYREVASRTAATKLSTEDS
Ga0209235_127814523300026296Grasslands SoilIASFFEEGEALIVPYERAAVVDAVSSVLADPELRARLARGGIAAARRTSWDHVTDLQEEIYREVASRTAETKFSTDGS
Ga0209236_117000713300026298Grasslands SoilEALVVPYEREAVVDAVRRVLADDELRARLARGGVEAARRTSWDRVTDRQEEIYREVAPTG
Ga0209058_133352213300026536SoilRAAVVEAVSSVLADPDLRARLARGGIAAARRTSWDHVTDIQEQIYRDVASRTASTKLSTDDS
Ga0209805_143845523300026542SoilGGLEAAHRMSWDRVTDRQEAIYRDVLASRTAATKCSTEVS
Ga0209474_1014900723300026550SoilLRERLARGGLEAAHRMSWDRVTDRQEAIYRDVLASRTAATKFSTEVS
Ga0247828_1035200413300028587SoilELRRSLAAGGVAAARRMSWERVAAHQEEIYREAIASRQASTRFSTDGS
Ga0307293_1024160313300028711SoilGSAVVGAVRQVLSDESLRSSLAQGGRAAAKRTSWDHVTDLQEEIYREVASRTAATKLSTDGS
Ga0307313_1005308123300028715SoilVLADPELRARLERGGIAAARRTSWDRVTDVQEEIYREVASRTAATKLSTEDS
Ga0307313_1007227723300028715SoilAARRTSWDHVTDVQEEIYRAVASRTAARKFSTDGS
Ga0307313_1012891613300028715SoilQSAVVEAIRRVLSDDRLREQLAQGGPAAARRMSWDHVTDAQEEIYRAVASRTAATKLSTDGS
Ga0307301_1007932113300028719SoilRLREQLAQGGPAAARRMSWDHVTDAQEQIYRAVASRTAATKLSTDGS
Ga0307317_1032003023300028720SoilQVLSDESLSSSLAQGGRAAAKRTSWDHVTDLQEEIYREVASRTAATKLSTDGS
Ga0307319_1001729343300028722SoilQSAVVEAIRRVLSDDRLRERLAQGGPAAARRMSWDHVTDAQEQIYRAVASRTAATKLSTDGS
Ga0307319_1021130613300028722SoilIAAARRTSWDRVTDVQEEIYREVASRTAATKLSTDDS
Ga0307282_1051932313300028784SoilLADPDLRARLARGGVAAARRTSWDHVTDVQEEIYREVASRTAATKLSTEDS
Ga0307282_1066655023300028784SoilYEQSAVVEAIRRVLSDDRLRERLAQGGPAAARRMSWDHVTDAQERIYRAVASRTAATKLSTDGS
Ga0307323_10000565103300028787SoilRLGRGGIAAARRTSWDHVTDVQEEIYRDVAARTAVTKLSTDES
Ga0307323_1012823613300028787SoilVPYERAPIVDALRNVLADRELRAQLARGGVAAARRTSWDRVTDVQEGIYREVASRTAATKLSTDDS
Ga0307299_1016660413300028793SoilRLAQGGVAAARRMSWDSVAAAQEEIYRAAASRTAATKLSTEGS
Ga0307299_1027746923300028793SoilEAVQSVLGDPDLRAQLARGGVAAARRTSWDHVTDVQEKIYREVASRTAATKLSTDDS
Ga0307287_1005108513300028796SoilRVLSDDRLRERLAQGGPAAARRMSWDHVTDAQEEIYRAVASRTAATKLSTDGS
Ga0307305_1001572553300028807SoilSDDRLRERLAQGGPAAARRMSWDHVTDAQEEIYRAVASRTAATKLSTDGS
Ga0307305_1023396623300028807SoilERLSQGGVAAARRTSWDRVAILQAEIYREVASSTAATKLSTDGS
Ga0307305_1052058913300028807SoilDSDLRARLARGGIAAARRTSWDHVTDLQEQIYRDVASRTAATKLSTDGS
Ga0307294_1015506623300028810SoilLRERLGRGGIAAARRTSWDHVTDVQEEIYRDVAARTAVTKLSTDES
Ga0307292_1001945723300028811SoilDRELHAQLARGGVAAARRTSWDRVTDVQEGIYREVASRTAATKLSTDDS
Ga0307296_1001163913300028819SoilVVPYERAAIVDALRNVLTDRELRAQLARGGVAAARRTSWDRVTDVQEGIYREVASRTAATKLSTDDS
Ga0307296_1003063313300028819SoilEALVVPYDGAAVIGAVRQVLGDGGLRERLAQGGVAAARRMSWDSVAAAQEEIYRAAASRTAATKLSTEGS
Ga0307296_1049460813300028819SoilARLARGGIAAARRTSWDHVTDLQEQIYRDVASRTAATKLSTDGS
Ga0307296_1078134313300028819SoilLSDRMLREQLSRGGVAAARRNSWDRVAKVQEQIYRDVASRTAATKLSTDGS
Ga0307312_1004086213300028828SoilQSAVVEAIRRVLSDDRLRERLAQGGPAAARRMSWDHVTDAQERIYRAVASRTAATKLSTDGS
Ga0307312_1113283213300028828SoilAGFFQDGEALIVPYERTAIVEAVRNVLTDPKLRAQLARGGIAAAQRTSWDSVTDVQEKIYRELASRTAATKFSTDGS
Ga0307314_1001702923300028872SoilRGRGGIAAARRTSWDHVTDVQEEIYRDVAARTAVTKLSTDES
Ga0307289_1022709613300028875SoilQVLSDESLRSRLAQGGRAAAKRTSWNHVTDLQEEIYREVASRTAATKLSTEGS
Ga0307278_1029069223300028878SoilPGEALVVPYEGSAVTAALRSVIEDPELRQSLAAGGLAAARRTSWQHMTVLQEEIYREVIASRTASTKSSTPGP
Ga0307300_1004284713300028880SoilYEQSAVVEAIRRVLSDDRLREQLAQGGPTAARRMSWDHVTDAQEQIYRAVASRTAATKLSTDGS
Ga0307277_1020618823300028881SoilEQSAVVQAIRRVLSDDRLRERLAQGGPAAARRMSWDHVTDAQEEIYRAVASRTAATKLSTDGS
Ga0307308_1063113013300028884SoilEALIVPYERTAIVEAVRNVLTDPKLRAQLARGGIAAAQRTSWDSVTDVQEKIYRELASRTAATKFSTDGS
Ga0247827_1088799613300028889SoilPTTCAVLRRVLVDEELRRSLSAGGVAAARRMSWEHVTDLQEEIYREVAASRTASTKRSTPGP
Ga0307468_10063868723300031740Hardwood Forest SoilSRGGITAARRNSWDRVAEVQEQIYREVASRTAATKLSTDGS
Ga0307468_10119549313300031740Hardwood Forest SoilDLRERLARGGPAAARRTSWDRVTDVQERLYSEIAARKASTEAS
Ga0302322_10011211733300031902FenGVEAARRNSWDRVTDLQEELYLEAIASVTATTNASTLGS
Ga0315278_1080794723300031997SedimentSLSEGGVAAARRMSWEHVTALQEEIYRAAIASRQASTSASTDGS
Ga0307416_10374498413300032002RhizosphereEGLRQQLARGGPAAARRMSWDHVTDVQEEIYRSVASRTAATKLSTDGS
Ga0307411_1156488023300032005RhizosphereALGATEAARRNAWDVVAERQEAIYRAAAARTVATKFSMLGS
Ga0372943_0524326_2_1693300034268SoilIRRVLSDSGLRAELAAGAVAAARRTSWDSVTDVQEALYRAVASRTADAKLSTDGS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.