Metagenome Family F087812

Basic Information
Family ID	F087812
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	39 residues
Representative Sequence	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK
Number of Associated Samples	92
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	48.18 %
% of genes near scaffold ends (potentially truncated)	18.18 %
% of genes from short scaffolds (< 2000 bps)	80.00 %
Associated GOLD sequencing projects	75
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (71.818 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (9.091 % of family members)
Environment Ontology (ENVO)	Unclassified (50.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (65.455 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF02870	Methyltransf_1N	51.82
PF00725	3HCDH	12.73
PF02737	3HCDH_N	10.00
PF13649	Methyltransf_25	4.55
PF13517	FG-GAP_3	2.73
PF12847	Methyltransf_18	1.82
PF07963	N_methyl	0.91
PF00534	Glycos_transf_1	0.91
PF08281	Sigma70_r4_2	0.91
PF03814	KdpA	0.91
PF01197	Ribosomal_L31	0.91
PF00005	ABC_tran	0.91
PF09130	DUF1932	0.91
PF07519	Tannase	0.91
PF02403	Seryl_tRNA_N	0.91
PF13361	UvrD_C	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	51.82
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	22.73
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	10.91
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	10.00
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	10.00
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	10.00
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	10.00
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	10.00
COG0172	Seryl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.91
COG0254	Ribosomal protein L31	Translation, ribosomal structure and biogenesis [J]	0.91
COG2060	K+-transporting ATPase, KdpA subunit	Inorganic ion transport and metabolism [P]	0.91

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.36 %
Unclassified	root	N/A	23.64 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.36 %
Unclassified	root	N/A	23.64 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.82 %
Unclassified	root	N/A	23.64 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	4.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	17.27 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	9.09 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	4.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	4.55 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	1.82 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.82 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.82 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.82 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.64 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.45 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	4.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.82 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100636059	Not Available	2531	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100636617	Not Available	526	Open in IMG/M
3300004157\|Ga0062590_102857986	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300005329\|Ga0070683_100027096	All Organisms → cellular organisms → Bacteria	5166	Open in IMG/M
3300005329\|Ga0070683_100039179	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4349	Open in IMG/M
3300005329\|Ga0070683_101138365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	750	Open in IMG/M
3300005338\|Ga0068868_100456731	All Organisms → cellular organisms → Bacteria	1112	Open in IMG/M
3300005345\|Ga0070692_10095218	All Organisms → cellular organisms → Bacteria	1624	Open in IMG/M
3300005355\|Ga0070671_100159915	Not Available	1904	Open in IMG/M
3300005439\|Ga0070711_101341055	Not Available	621	Open in IMG/M
3300005458\|Ga0070681_10272689	All Organisms → cellular organisms → Bacteria	1603	Open in IMG/M
3300005471\|Ga0070698_101149218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	725	Open in IMG/M
3300005529\|Ga0070741_10000349	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	173346	Open in IMG/M
3300005534\|Ga0070735_10009808	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	7411	Open in IMG/M
3300005535\|Ga0070684_100039364	All Organisms → cellular organisms → Bacteria → Proteobacteria	4066	Open in IMG/M
3300005538\|Ga0070731_10304171	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1059	Open in IMG/M
3300005541\|Ga0070733_10980650	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300005542\|Ga0070732_10250967	Not Available	1060	Open in IMG/M
3300005543\|Ga0070672_100215533	All Organisms → cellular organisms → Bacteria	1609	Open in IMG/M
3300005549\|Ga0070704_101831588	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300005563\|Ga0068855_100020585	All Organisms → cellular organisms → Bacteria	7911	Open in IMG/M
3300005563\|Ga0068855_100411081	All Organisms → cellular organisms → Bacteria	1481	Open in IMG/M
3300005563\|Ga0068855_100598070	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300005563\|Ga0068855_101884187	All Organisms → cellular organisms → Bacteria → Proteobacteria	606	Open in IMG/M
3300005566\|Ga0066693_10390532	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300005614\|Ga0068856_100115273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2686	Open in IMG/M
3300005614\|Ga0068856_100161683	All Organisms → cellular organisms → Bacteria	2250	Open in IMG/M
3300005718\|Ga0068866_10718403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	687	Open in IMG/M
3300005829\|Ga0074479_10642098	All Organisms → cellular organisms → Bacteria	1143	Open in IMG/M
3300005836\|Ga0074470_11397136	All Organisms → cellular organisms → Bacteria	2109	Open in IMG/M
3300005841\|Ga0068863_100705340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1003	Open in IMG/M
3300005842\|Ga0068858_100137760	All Organisms → cellular organisms → Bacteria	2291	Open in IMG/M
3300005842\|Ga0068858_100819939	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300005843\|Ga0068860_100922116	Not Available	890	Open in IMG/M
3300006163\|Ga0070715_10304455	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300006173\|Ga0070716_100904202	All Organisms → cellular organisms → Bacteria → Proteobacteria	691	Open in IMG/M
3300006175\|Ga0070712_100695908	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300006176\|Ga0070765_100388071	All Organisms → cellular organisms → Bacteria → Proteobacteria	1302	Open in IMG/M
3300006237\|Ga0097621_101380941	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300006358\|Ga0068871_100967998	Not Available	791	Open in IMG/M
3300006358\|Ga0068871_101034024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	766	Open in IMG/M
3300006638\|Ga0075522_10000023	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	82010	Open in IMG/M
3300006804\|Ga0079221_10138062	All Organisms → cellular organisms → Bacteria → Proteobacteria	1257	Open in IMG/M
3300006854\|Ga0075425_101193635	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
3300009098\|Ga0105245_10635406	All Organisms → cellular organisms → Bacteria	1097	Open in IMG/M
3300009098\|Ga0105245_11392607	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300009098\|Ga0105245_12051744	Not Available	625	Open in IMG/M
3300009143\|Ga0099792_10499616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	761	Open in IMG/M
3300009147\|Ga0114129_12279899	Not Available	650	Open in IMG/M
3300009174\|Ga0105241_11085913	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	753	Open in IMG/M
3300009176\|Ga0105242_10610295	All Organisms → cellular organisms → Bacteria	1055	Open in IMG/M
3300009177\|Ga0105248_11166972	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300009545\|Ga0105237_10199699	All Organisms → cellular organisms → Bacteria	1999	Open in IMG/M
3300010359\|Ga0126376_11622325	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300010375\|Ga0105239_13472972	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300010375\|Ga0105239_13580092	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300010379\|Ga0136449_100411802	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	2392	Open in IMG/M
3300010403\|Ga0134123_11803716	Not Available	665	Open in IMG/M
3300010403\|Ga0134123_12344713	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300012982\|Ga0168317_1036836	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300013104\|Ga0157370_10006591	All Organisms → cellular organisms → Bacteria → Acidobacteria	12769	Open in IMG/M
3300013296\|Ga0157374_10213956	All Organisms → cellular organisms → Bacteria	1890	Open in IMG/M
3300013297\|Ga0157378_12514095	Not Available	567	Open in IMG/M
3300013307\|Ga0157372_11765847	All Organisms → cellular organisms → Bacteria → Proteobacteria	711	Open in IMG/M
3300014325\|Ga0163163_10403238	All Organisms → cellular organisms → Bacteria	1426	Open in IMG/M
3300014501\|Ga0182024_10571979	All Organisms → cellular organisms → Bacteria	1421	Open in IMG/M
3300014969\|Ga0157376_10218288	All Organisms → cellular organisms → Bacteria	1764	Open in IMG/M
3300014969\|Ga0157376_12508130	Not Available	555	Open in IMG/M
3300017966\|Ga0187776_11164013	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	576	Open in IMG/M
3300017973\|Ga0187780_11399478	Not Available	515	Open in IMG/M
3300017993\|Ga0187823_10386616	Not Available	506	Open in IMG/M
3300020579\|Ga0210407_10658264	Not Available	814	Open in IMG/M
3300021170\|Ga0210400_10628562	All Organisms → cellular organisms → Bacteria → Proteobacteria	885	Open in IMG/M
3300021407\|Ga0210383_10144063	Not Available	2023	Open in IMG/M
3300021478\|Ga0210402_10842196	All Organisms → cellular organisms → Bacteria	843	Open in IMG/M
3300022309\|Ga0224510_10522832	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300025862\|Ga0209483_1000125	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	74211	Open in IMG/M
3300025898\|Ga0207692_10111800	Not Available	1516	Open in IMG/M
3300025899\|Ga0207642_10389769	Not Available	831	Open in IMG/M
3300025903\|Ga0207680_10364268	Not Available	1017	Open in IMG/M
3300025905\|Ga0207685_10296592	Not Available	798	Open in IMG/M
3300025911\|Ga0207654_10435344	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	917	Open in IMG/M
3300025911\|Ga0207654_10721876	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300025912\|Ga0207707_10783457	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300025913\|Ga0207695_10004411	All Organisms → cellular organisms → Bacteria → Acidobacteria	19221	Open in IMG/M
3300025914\|Ga0207671_10368946	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300025915\|Ga0207693_11440390	Not Available	510	Open in IMG/M
3300025920\|Ga0207649_10382924	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300025924\|Ga0207694_10021555	All Organisms → cellular organisms → Bacteria	4883	Open in IMG/M
3300025924\|Ga0207694_11639394	All Organisms → cellular organisms → Bacteria → Proteobacteria	542	Open in IMG/M
3300025927\|Ga0207687_11139967	Not Available	670	Open in IMG/M
3300025935\|Ga0207709_10268619	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1254	Open in IMG/M
3300025935\|Ga0207709_10309290	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300025942\|Ga0207689_10004744	All Organisms → cellular organisms → Bacteria → Acidobacteria	12258	Open in IMG/M
3300025949\|Ga0207667_10000776	All Organisms → cellular organisms → Bacteria → Acidobacteria	41369	Open in IMG/M
3300025981\|Ga0207640_10932480	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300026035\|Ga0207703_10291341	Not Available	1486	Open in IMG/M
3300026095\|Ga0207676_10588843	All Organisms → cellular organisms → Bacteria	1067	Open in IMG/M
3300027725\|Ga0209178_1057930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1250	Open in IMG/M
3300027869\|Ga0209579_10797868	All Organisms → cellular organisms → Bacteria → Proteobacteria	510	Open in IMG/M
3300027903\|Ga0209488_10480949	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300028381\|Ga0268264_10839951	Not Available	919	Open in IMG/M
3300028800\|Ga0265338_10727887	Not Available	683	Open in IMG/M
3300028906\|Ga0308309_10258235	All Organisms → cellular organisms → Bacteria	1460	Open in IMG/M
3300031231\|Ga0170824_105718060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	518	Open in IMG/M
3300031231\|Ga0170824_127581706	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300031938\|Ga0308175_100170911	All Organisms → cellular organisms → Bacteria	2108	Open in IMG/M
3300032160\|Ga0311301_10334485	All Organisms → cellular organisms → Bacteria	2387	Open in IMG/M
3300032180\|Ga0307471_103195701	Not Available	581	Open in IMG/M
3300034090\|Ga0326723_0228006	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	50.91%
Host-Associated	Host-Associated	49.09%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	49.09%
Terrestrial	Environmental → Terrestrial	47.27%
Aquatic	Environmental → Aquatic	3.64%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	45.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.18%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.27%
Roots	Host-Associated → Plants → Roots	3.64%
Sediment	Environmental → Aquatic → Sediment	1.82%
Freshwater	Environmental → Aquatic → Freshwater	0.91%
Marine	Environmental → Aquatic → Marine	0.91%
Peat	Environmental → Terrestrial → Peat	0.91%
Geologic	Environmental → Terrestrial → Geologic	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	26.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.64%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	17.27%
Loam	Environmental → Terrestrial → Soil → Loam	16.36%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.55%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	3.64%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.82%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.91%
Sediment	Environmental → Aquatic → Marine → Sediment	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.91%
Mine	Environmental → Terrestrial → Geologic → Mine	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	17.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	14.55%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	11.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.55%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	3.64%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.73%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.73%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.82%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.82%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.82%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.91%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.91%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.09%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	9.09%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	7.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	6.36%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.45%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	5.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.73%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.82%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.82%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.82%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.82%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.82%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.82%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.82%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.82%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.91%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.91%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.91%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.91%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.91%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012982	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017993	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300022309	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1006360593	3300000364	Soil	MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK*
INPhiseqgaiiFebDRAFT_1006366172	3300000364	Soil	MKTHMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK*
Ga0062590_1028579862	3300004157	Soil	MNMALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0070683_1000270963	3300005329	Corn Rhizosphere	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0070683_1000391796	3300005329	Corn Rhizosphere	MERPMALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK*
Ga0070683_1011383652	3300005329	Corn Rhizosphere	METPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0068868_1004567313	3300005338	Miscanthus Rhizosphere	MHMALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0070692_100952183	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MERPMALAVLLFVFFVIIVLIALFIFPPTKWTEWFVKKDK*
Ga0070671_1001599152	3300005355	Switchgrass Rhizosphere	MKRPMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVKNDKK*
Ga0070711_1013410551	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	ETPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK*
Ga0070681_102726893	3300005458	Corn Rhizosphere	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK*
Ga0070698_1011492182	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MKRPMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVKKDKK*
Ga0070741_1000034937	3300005529	Surface Soil	MKTPMALAVLLFVFFMIVVLIALFIFPPNKWVEWFVKKEKK*
Ga0070735_100098085	3300005534	Surface Soil	MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDDKKR*
Ga0070684_1000393645	3300005535	Corn Rhizosphere	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK*
Ga0070731_103041712	3300005538	Surface Soil	MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNRKK*
Ga0070733_109806502	3300005541	Surface Soil	MALFVLLMVFFFVVVLIALFIFPPNKWVEWLEKDKKK*
Ga0070732_102509673	3300005542	Surface Soil	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK*
Ga0070672_1002155332	3300005543	Miscanthus Rhizosphere	MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0070704_1018315882	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LSIRWRHMALAVLLFVFFVIVVLIALFIFPPNKWVEWFANKDKK*
Ga0068855_1000205856	3300005563	Corn Rhizosphere	MALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK*
Ga0068855_1004110813	3300005563	Corn Rhizosphere	MALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK*
Ga0068855_1005980702	3300005563	Corn Rhizosphere	MALAVLLFVFFVIIVLITLFIFPPTKWVKWFANPGKKK*
Ga0068855_1018841872	3300005563	Corn Rhizosphere	MALAVLLFVFFVIIVLIALFIFPPTKWTEWFVKKDK*
Ga0066693_103905322	3300005566	Soil	HSHSIRCRDMALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK*
Ga0068856_1001152732	3300005614	Corn Rhizosphere	MALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK*
Ga0068856_1001616832	3300005614	Corn Rhizosphere	MALAVLLFVFFVIIVLIGLFVFPPTAWVKWFANDHKKK*
Ga0068866_107184032	3300005718	Miscanthus Rhizosphere	MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0074479_106420982	3300005829	Sediment (Intertidal)	MALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0074470_113971363	3300005836	Sediment (Intertidal)	MALAVLLFVFFVIVVLIALFIFPPNKWVEWFANKDKK*
Ga0068863_1007053402	3300005841	Switchgrass Rhizosphere	MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK*
Ga0068858_1001377603	3300005842	Switchgrass Rhizosphere	MALAVLLFVFFIIIALIGLFVFPPTKWVKWFANDNKKR*
Ga0068858_1008199392	3300005842	Switchgrass Rhizosphere	MALAVLLFVFFVIIALIGLFVFPPTKWVKWFANDNKKR*
Ga0068860_1009221163	3300005843	Switchgrass Rhizosphere	MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKEKKIEKK*
Ga0070715_103044552	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	LSIRWRHMALAVLLFVFFVIVVLIAFFIFPPNKWVEWFVNKDKK*
Ga0070716_1009042022	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MALAVLLFVFFMIIVLIGLFVFPPTKWVKWFASDGKKK*
Ga0070712_1006959082	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDHKKR*
Ga0070765_1003880712	3300006176	Soil	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK*
Ga0097621_1013809412	3300006237	Miscanthus Rhizosphere	MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDNKKR*
Ga0068871_1009679982	3300006358	Miscanthus Rhizosphere	MALAVLLFVFFVIVVLIAFFIFPPNKWVEWFVNKDKK*
Ga0068871_1010340242	3300006358	Miscanthus Rhizosphere	MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK*
Ga0075522_1000002315	3300006638	Arctic Peat Soil	MALAFLLFVFFVIIVLIGLFIFPPTKWVERFANKEKK*
Ga0079221_101380622	3300006804	Agricultural Soil	MKTPMALVVLLFVFFMIVVLIALFIFPPNKWVEWFVKKDKK*
Ga0075425_1011936352	3300006854	Populus Rhizosphere	MALAVLLFVFFVIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0105245_106354062	3300009098	Miscanthus Rhizosphere	MALAVLLFVFFVIIALIGLFVFPPTSWVKWFASENKKK*
Ga0105245_113926072	3300009098	Miscanthus Rhizosphere	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKGKK*
Ga0105245_120517442	3300009098	Miscanthus Rhizosphere	MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVNKDKK*
Ga0099792_104996162	3300009143	Vadose Zone Soil	MKTLMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0114129_122798992	3300009147	Populus Rhizosphere	MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0105241_110859131	3300009174	Corn Rhizosphere	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVNRDKK*
Ga0105242_106102953	3300009176	Miscanthus Rhizosphere	METHMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK*
Ga0105248_111669721	3300009177	Switchgrass Rhizosphere	LAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK*
Ga0105237_101996992	3300009545	Corn Rhizosphere	MLSIRWRHMALAVLLFVFFVIVVLIGLFVFPPTKWVKWFANDNKKR*
Ga0126376_116223252	3300010359	Tropical Forest Soil	MALAVLLFVFFVIVLLIAFFIFPPNKWVEWFVNKDKK*
Ga0105239_134729721	3300010375	Corn Rhizosphere	MALAVLLFVFFVIVVLIALFIFPPNKWVEWFAKKDKK*
Ga0105239_135800922	3300010375	Corn Rhizosphere	MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKDKKIEKK*
Ga0136449_1004118023	3300010379	Peatlands Soil	MALAVLLFVFFVIIVLIGLFVFPPTRWVKWFANDNKKR*
Ga0134123_118037161	3300010403	Terrestrial Soil	MALAVLLFVFFIIVLLIALFIFPPNKWVEWFVNKEKKIEQK*
Ga0134123_123447132	3300010403	Terrestrial Soil	MALVVLLFVFFVIVLLIAFFIFPPNKWVEWFVKKDKK*
Ga0168317_10368362	3300012982	Weathered Mine Tailings	MALAVLLFVFFVIIVLIGLFIFPPTAWVKWFANNDKKK*
Ga0157370_100065911	3300013104	Corn Rhizosphere	PQYKMERHMALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK*
Ga0157374_102139563	3300013296	Miscanthus Rhizosphere	KNMALAVLLFVFFVIIALIGLFVFPPTSWVKWFASENKKK*
Ga0157378_125140951	3300013297	Miscanthus Rhizosphere	MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDNKKR
Ga0157372_117658472	3300013307	Corn Rhizosphere	MALAVLLFVFFVISVLIALFIFPPTKWTEWFVKKDK*
Ga0163163_104032383	3300014325	Switchgrass Rhizosphere	LAVLLFVFFIIIALIGLFVFPPTKWVKWFANDNKKR*
Ga0182024_105719791	3300014501	Permafrost	MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNKK
Ga0157376_102182881	3300014969	Miscanthus Rhizosphere	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFADKDKK*
Ga0157376_125081302	3300014969	Miscanthus Rhizosphere	MALAVLLFVFFIIVILIALLIFPPNKSVEWFVKNDKK*
Ga0187776_111640132	3300017966	Tropical Peatland	MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKDKK
Ga0187780_113994782	3300017973	Tropical Peatland	MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFASGDKKK
Ga0187823_103866162	3300017993	Freshwater Sediment	MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDDKKK
Ga0210407_106582642	3300020579	Soil	WRHMALAVLLFVFFIIVVLIALFVFPPNKWVEWFANKDKK
Ga0210400_106285622	3300021170	Soil	MALAVLLFVFFVIIALIGLFVFPPTKWVEWFASQNKKK
Ga0210383_101440633	3300021407	Soil	MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNKKK
Ga0210402_108421962	3300021478	Soil	MALAVLLFVFFVIVVLIALFVFPPTKWVKWFANDNKKR
Ga0224510_105228322	3300022309	Sediment	TIRTTMALAFLLFVFFIVVAMIALFIFPPTKWVQWFYNTDDKRE
Ga0209483_100012556	3300025862	Arctic Peat Soil	MALAFLLFVFFVIIVLIGLFIFPPTKWVERFANKEKK
Ga0207692_101118003	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MALAVLLFVFFVIIVLIGLFVFPPTAWVKWFANDHKKK
Ga0207642_103897692	3300025899	Miscanthus Rhizosphere	MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK
Ga0207680_103642683	3300025903	Switchgrass Rhizosphere	MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK
Ga0207685_102965921	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	RWSDMALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDHKKR
Ga0207654_104353442	3300025911	Corn Rhizosphere	MALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK
Ga0207654_107218762	3300025911	Corn Rhizosphere	MALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK
Ga0207707_107834572	3300025912	Corn Rhizosphere	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK
Ga0207695_1000441110	3300025913	Corn Rhizosphere	MALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK
Ga0207671_103689462	3300025914	Corn Rhizosphere	MLSIRWRHMALAVLLFVFFVIVVLIGLFVFPPTKWVKWFANDNKKR
Ga0207693_114403902	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	IEWRHMSLAVLLFVFFVIIVLITLFIFPPTKWVKWFANDNKKR
Ga0207649_103829241	3300025920	Corn Rhizosphere	YAQYKMETRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK
Ga0207694_100215553	3300025924	Corn Rhizosphere	MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK
Ga0207694_116393942	3300025924	Corn Rhizosphere	MALVVLLLVFFFIIVLITLFIFPPTKWVKWFHQQDKKK
Ga0207687_111399672	3300025927	Miscanthus Rhizosphere	GDNMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK
Ga0207709_102686192	3300025935	Miscanthus Rhizosphere	MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK
Ga0207709_103092903	3300025935	Miscanthus Rhizosphere	MHMALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK
Ga0207689_100047442	3300025942	Miscanthus Rhizosphere	MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK
Ga0207667_1000077618	3300025949	Corn Rhizosphere	MERHMALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK
Ga0207640_109324803	3300025981	Corn Rhizosphere	KMERPMALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKN
Ga0207703_102913413	3300026035	Switchgrass Rhizosphere	MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDDKKR
Ga0207676_105888432	3300026095	Switchgrass Rhizosphere	MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK
Ga0209178_10579302	3300027725	Agricultural Soil	MKTPMALVVLLFVFFMIVVLIALFIFPPNKWVEWFVKKDKK
Ga0209579_107978682	3300027869	Surface Soil	MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNRKK
Ga0209488_104809491	3300027903	Vadose Zone Soil	MKTLMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK
Ga0268264_108399513	3300028381	Switchgrass Rhizosphere	MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKEKKIEKK
Ga0265338_107278872	3300028800	Rhizosphere	MALAVLLFVFFVIIALIGLFVFPPTKWVKWFANDNKKR
Ga0308309_102582352	3300028906	Soil	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK
Ga0170824_1057180602	3300031231	Forest Soil	METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKSNKK
Ga0170824_1275817061	3300031231	Forest Soil	RHMALAVLLFVFFIIVVLIALFIFPPNKWVEWFADKNKK
Ga0308175_1001709112	3300031938	Soil	MALAVLLFVFFCIIVLIGLFVFPPTQWVKWFAKDDKKR
Ga0311301_103344853	3300032160	Peatlands Soil	MRVMALAVLLFVFFVIIVLIGLFVFPPTRWVKWFANDNKKR
Ga0307471_1031957012	3300032180	Hardwood Forest Soil	WRHMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK
Ga0326723_0228006_319_432	3300034090	Peat Soil	MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087812

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign