NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087635

Metagenome / Metatranscriptome Family F087635

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087635
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 47 residues
Representative Sequence AGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA
Number of Associated Samples 100
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.45 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.545 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.909 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.84%    β-sheet: 0.00%    Coil/Unstructured: 56.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00069Pkinase 46.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 185.45

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.55 %
UnclassifiedrootN/A15.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0488419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia987Open in IMG/M
3300004479|Ga0062595_102691785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.2501Open in IMG/M
3300005166|Ga0066674_10431560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300005177|Ga0066690_10193179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.21353Open in IMG/M
3300005341|Ga0070691_10373164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300005434|Ga0070709_11545737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.2539Open in IMG/M
3300005437|Ga0070710_10329648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1005Open in IMG/M
3300005438|Ga0070701_10595034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300005444|Ga0070694_100229907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1395Open in IMG/M
3300005445|Ga0070708_101476710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300005518|Ga0070699_100732907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300005575|Ga0066702_10176185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SS1282Open in IMG/M
3300005614|Ga0068856_100465782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1284Open in IMG/M
3300005718|Ga0068866_10230643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1123Open in IMG/M
3300005764|Ga0066903_102075759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1093Open in IMG/M
3300006028|Ga0070717_10257804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1542Open in IMG/M
3300006173|Ga0070716_100883229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces698Open in IMG/M
3300006173|Ga0070716_101590572Not Available536Open in IMG/M
3300006173|Ga0070716_101734516Not Available516Open in IMG/M
3300006173|Ga0070716_101766085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.2511Open in IMG/M
3300006173|Ga0070716_101780935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.2509Open in IMG/M
3300006175|Ga0070712_101463159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300006755|Ga0079222_10933935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300006804|Ga0079221_10201768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1090Open in IMG/M
3300006954|Ga0079219_11948373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 303MFCol5.2557Open in IMG/M
3300007076|Ga0075435_100787649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia827Open in IMG/M
3300007265|Ga0099794_10289651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300009012|Ga0066710_100769525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1473Open in IMG/M
3300009092|Ga0105250_10388811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora617Open in IMG/M
3300009148|Ga0105243_12563144Not Available549Open in IMG/M
3300009177|Ga0105248_12330301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora610Open in IMG/M
3300009553|Ga0105249_10753251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1036Open in IMG/M
3300009700|Ga0116217_10624350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300010048|Ga0126373_12717054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces552Open in IMG/M
3300010337|Ga0134062_10331661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces728Open in IMG/M
3300010361|Ga0126378_12053772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300010371|Ga0134125_10723937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1096Open in IMG/M
3300010373|Ga0134128_11436106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300010373|Ga0134128_12951157Not Available523Open in IMG/M
3300010375|Ga0105239_11514303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii775Open in IMG/M
3300010401|Ga0134121_10893934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300011119|Ga0105246_11160526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300012198|Ga0137364_10383295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300012198|Ga0137364_10883251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300012206|Ga0137380_10219324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1720Open in IMG/M
3300012207|Ga0137381_10678693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae896Open in IMG/M
3300012209|Ga0137379_10147760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae2258Open in IMG/M
3300012210|Ga0137378_11388143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300012350|Ga0137372_11050216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces564Open in IMG/M
3300012351|Ga0137386_10347149Not Available1068Open in IMG/M
3300012354|Ga0137366_10776352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia681Open in IMG/M
3300012356|Ga0137371_10982371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MA3_2.13641Open in IMG/M
3300012363|Ga0137390_11580789Not Available594Open in IMG/M
3300012917|Ga0137395_10269345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1200Open in IMG/M
3300012958|Ga0164299_10164145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1245Open in IMG/M
3300012961|Ga0164302_11471341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300013104|Ga0157370_11135192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300013105|Ga0157369_10913880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300015371|Ga0132258_12719112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1234Open in IMG/M
3300015373|Ga0132257_103371838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300017937|Ga0187809_10360770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae547Open in IMG/M
3300017959|Ga0187779_10531298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii781Open in IMG/M
3300018482|Ga0066669_10820862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales825Open in IMG/M
3300020081|Ga0206354_10036504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1356Open in IMG/M
3300020581|Ga0210399_11592858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae504Open in IMG/M
3300021178|Ga0210408_10214496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1531Open in IMG/M
3300021405|Ga0210387_10367343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei1273Open in IMG/M
3300021420|Ga0210394_11074410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300021420|Ga0210394_11610972Not Available546Open in IMG/M
3300021479|Ga0210410_11665491Not Available531Open in IMG/M
3300025903|Ga0207680_10456582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia907Open in IMG/M
3300025905|Ga0207685_10356943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii739Open in IMG/M
3300025906|Ga0207699_10130343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1639Open in IMG/M
3300025910|Ga0207684_11485825Not Available552Open in IMG/M
3300025911|Ga0207654_11121158Not Available573Open in IMG/M
3300025913|Ga0207695_11607124Not Available531Open in IMG/M
3300025915|Ga0207693_11007882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300025916|Ga0207663_11632918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300025921|Ga0207652_11236138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300025924|Ga0207694_11888289Not Available501Open in IMG/M
3300025928|Ga0207700_11601247Not Available576Open in IMG/M
3300025928|Ga0207700_11890547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300025939|Ga0207665_11360814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae566Open in IMG/M
3300026335|Ga0209804_1108443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei1270Open in IMG/M
3300026555|Ga0179593_1040015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1916Open in IMG/M
3300027371|Ga0209418_1071949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300027846|Ga0209180_10684973Not Available559Open in IMG/M
3300031572|Ga0318515_10470745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300031681|Ga0318572_10290546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia965Open in IMG/M
3300031719|Ga0306917_10135000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae1815Open in IMG/M
3300031740|Ga0307468_101020097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300031770|Ga0318521_10102281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1579Open in IMG/M
3300031821|Ga0318567_10104235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1538Open in IMG/M
3300031845|Ga0318511_10181965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300031890|Ga0306925_10225344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2022Open in IMG/M
3300031890|Ga0306925_10465370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SS1350Open in IMG/M
3300031890|Ga0306925_11713091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales606Open in IMG/M
3300031896|Ga0318551_10845850Not Available533Open in IMG/M
3300031910|Ga0306923_10384995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1597Open in IMG/M
3300031938|Ga0308175_101316738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300031942|Ga0310916_10906276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300032010|Ga0318569_10128530Not Available1157Open in IMG/M
3300032064|Ga0318510_10447650Not Available554Open in IMG/M
3300032067|Ga0318524_10175591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1090Open in IMG/M
3300032068|Ga0318553_10127616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1310Open in IMG/M
3300032090|Ga0318518_10370749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300032174|Ga0307470_10423022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces949Open in IMG/M
3300032783|Ga0335079_10135272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2775Open in IMG/M
3300032954|Ga0335083_10148076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2221Open in IMG/M
3300033134|Ga0335073_10215037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Phaeacidiphilus → Phaeacidiphilus oryzae2373Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere20.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_048841923300000156Sugar Cane Bagasse Incubating BioreactorFWWTAGILVGGAIVSGVLFRPGPLYRRDGQSPQDAGVLAQTEAGPAFPA*
Ga0062595_10269178513300004479SoilQALAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA*
Ga0066674_1043156023300005166SoilAGIFAGGAIVGGLLFRRGPLYRKDGPVQQDAGVMTGTEAGPALLA*
Ga0066690_1019317923300005177SoilAFWWIAGIFAGGAIVGGLLFRRGPLYRKDSQVQQDAGVMTGTEAGPALLA*
Ga0070691_1037316413300005341Corn, Switchgrass And Miscanthus RhizosphereGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA*
Ga0070709_1154573713300005434Corn, Switchgrass And Miscanthus RhizosphereLAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0070710_1032964813300005437Corn, Switchgrass And Miscanthus RhizosphereFWWIAGIFAGGAIIGGALFRRGPLGGKDSPAQVRTVGTEAGRALPA*
Ga0070701_1059503423300005438Corn, Switchgrass And Miscanthus RhizosphereVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA*
Ga0070694_10022990723300005444Corn, Switchgrass And Miscanthus RhizosphereAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMAQTEAGPALLP*
Ga0070708_10147671023300005445Corn, Switchgrass And Miscanthus RhizosphereGAIVGGLLFRRGPLHRDDGQVQQDAGVMAETEAGPVLPA*
Ga0070699_10073290713300005518Corn, Switchgrass And Miscanthus RhizosphereGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA*
Ga0066702_1017618513300005575SoilWIAGIFAGGAIVGGLLFRRGPLYRKDSQVQQDAGVMTGTEAGPALLA*
Ga0068856_10046578213300005614Corn RhizosphereIAGIFAGGAIVGGALFRRGPLVRKDDQAQVKAMETEAGPALPA*
Ga0068866_1023064313300005718Miscanthus RhizosphereGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA*
Ga0066903_10207575923300005764Tropical Forest SoilGILVGGAIVSGALFRPGPLYRRDGQSPQDAGVLAQTEAGPAFPA*
Ga0070717_1025780413300006028Corn, Switchgrass And Miscanthus RhizosphereWWIAGIFASGAIVGGLLFRRGPLYRKDGQVQQDAGVMTETQAGPALLA*
Ga0070716_10088322913300006173Corn, Switchgrass And Miscanthus RhizosphereFWWIAGIFAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMTGTEAGPALLA*
Ga0070716_10159057213300006173Corn, Switchgrass And Miscanthus RhizosphereAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETAAGPVLPA*
Ga0070716_10173451623300006173Corn, Switchgrass And Miscanthus RhizosphereDTAFWWTAGILVGGAIVAGALFRAGPLYRKDEQARRDGAPMAAAGTEAGPALPM*
Ga0070716_10176608513300006173Corn, Switchgrass And Miscanthus RhizosphereWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA*
Ga0070716_10178093513300006173Corn, Switchgrass And Miscanthus RhizosphereWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETKAGPVLPA*
Ga0070712_10146315913300006175Corn, Switchgrass And Miscanthus RhizosphereWIAGIFAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMTGTEAGPALLA*
Ga0079222_1093393523300006755Agricultural SoilGILAGGAIVAGALFRSGPLYRKDGQGQQSAGVMAGTEAGPALLA*
Ga0079221_1020176813300006804Agricultural SoilAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0079219_1194837313300006954Agricultural SoilAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA*
Ga0075435_10078764913300007076Populus RhizosphereGQALAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAEVMAETKVSPVLPA
Ga0099794_1028965113300007265Vadose Zone SoilAGIFAGGAIVGGLLFRRGPLYRKDGQGQQATGVMAGTEAGPALLA*
Ga0066710_10076952513300009012Grasslands SoilFAGGAIVGGLLFRRGPLYRKDGPVQQDAGVMTGTEAGPALLA
Ga0105250_1038881123300009092Switchgrass RhizosphereAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0105243_1256314413300009148Miscanthus RhizosphereGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQEAGVMAETEAGPVLPA*
Ga0105248_1233030123300009177Switchgrass RhizosphereAGGAIVGGLLLRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0105249_1075325113300009553Switchgrass RhizosphereIFTGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETKAGPVLPA*
Ga0116217_1062435013300009700Peatlands SoilAFWWIADIFAAGAIIGGSLLRRVPLYRKDSPAQQDAGVMAPEAGPVLPA*
Ga0126373_1271705413300010048Tropical Forest SoilAIVGGLLFRRGPLYRKDGQGQPAAGVMAGTEAGPALLS*
Ga0134062_1033166123300010337Grasslands SoilAIIGGLLFRRGPLRRKDGQVQQPAGVMAETEAGPALLA*
Ga0126378_1205377223300010361Tropical Forest SoilAFWWTAGILVGGAIVGGILFRPGPLYRRDGQSPQDAGVLAQTEAGPAFPA*
Ga0134125_1072393723300010371Terrestrial SoilDVAFWWVAGIFAGGAIVGGLLLRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0134128_1143610613300010373Terrestrial SoilDTAFWWIAGIFAGGAIVGGALFRRGPLVRKDDQAQVTAMETEAGPALPA*
Ga0134128_1295115713300010373Terrestrial SoilFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA*
Ga0105239_1151430313300010375Corn RhizosphereGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAQTEAGPALLP*
Ga0134121_1089393413300010401Terrestrial SoilYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0105246_1116052623300011119Miscanthus RhizosphereAGIFAGGAIVGGALFRRGPLVRKDDQAQVKAMETEAGPALPA*
Ga0137364_1038329523300012198Vadose Zone SoilAFWWVAGIFAGGVIVGGLLFRRGPLRRDDGQVQQDAEVMAETKVGPVLPA*
Ga0137364_1088325123300012198Vadose Zone SoilGGAIVGGLLFRRGPLYRTDGPVQQDAGVMTGTEAGPALLA*
Ga0137380_1021932413300012206Vadose Zone SoilYDTAFWWVAGIFAGGAIVGGLLLRRGPLRRDDGQVQQDAGAMAEPEAGPVLPA*
Ga0137381_1067869323300012207Vadose Zone SoilWTAGILAAGAVVGGALFRRGPLYRKNDPVQVTAPETEPGPVLPA*
Ga0137379_1014776023300012209Vadose Zone SoilVGGLLFRRGPLYRTDGPVQQDAGVMTGTEAGPALLA*
Ga0137378_1138814323300012210Vadose Zone SoilWWIAGIFAGGAIVGGTLLRRGALYRKDSPSQPDALVPAETEAGPAFPA*
Ga0137372_1105021613300012350Vadose Zone SoilGGAIVAGALFRAGPLYRKDEQAQQDGAPMAAAGTEAGPALPA*
Ga0137386_1034714923300012351Vadose Zone SoilWTAGIFAAGAIIGGALFRRGPLYRQDGQAQQAAGVMTAETEAGPALPA*
Ga0137366_1077635223300012354Vadose Zone SoilAIVAGALFRAGPLYRKDEQAQQDGAPMAAAGTEAGPALPA*
Ga0137371_1098237113300012356Vadose Zone SoilDTAFWWVAGIFAGGAIVGGLLLRRGPLRRDYGQVQQDAGAMAEPEAGPVLPA*
Ga0137390_1158078923300012363Vadose Zone SoilGIFAAGAIIGGALFRRGPLYRQDGQAQQAAGVMTAETEAGPALPT*
Ga0137395_1026934523300012917Vadose Zone SoilAAGAIIGGALFRRGPLYRQDGQAQQAAGVMTAETEAGPALPA*
Ga0164299_1016414523300012958SoilWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA*
Ga0164302_1147134113300012961SoilGIFAGGAIVGGVLFRRGPLVRKDDQAQVTAMETEVGPALPA*
Ga0157370_1113519223300013104Corn RhizosphereIAGIFAGGAIVGGALFRRGPLVRKDDQAQVTAMETEAGPALPA*
Ga0157369_1091388013300013105Corn RhizosphereAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA*
Ga0132258_1271911223300015371Arabidopsis RhizosphereDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA*
Ga0132257_10337183813300015373Arabidopsis RhizosphereVCGLLLRRGPLRRDDGQVQQDAGVMAETEAGPVRPA*
Ga0187809_1036077013300017937Freshwater SedimentGGAIVAGLLFRRGPLYRKDAQGQQPAGVLAETEAGPALLA
Ga0187779_1053129813300017959Tropical PeatlandILAGGAIVAAALFRSGPLYRKDSPAAPGAGVMAVETEAGPALPA
Ga0066669_1082086223300018482Grasslands SoilAGGAIVGGLLFRRGPLYRKDSQVQQDAGVMTGTEAGPALLA
Ga0206354_1003650413300020081Corn, Switchgrass And Miscanthus RhizosphereAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA
Ga0210399_1159285813300020581SoilFWWIAGIFAGGAIVGGVLLRRGPLYRKDDQVQPGTGVMAQSDAGPAPLA
Ga0210408_1021449613300021178SoilFWWIAGIFAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMTGTEAGPALLA
Ga0210387_1036734313300021405SoilFWWIAGIFACGAIVGGLLFRRGPLYRKDGQGQQAAGVMAGIEAGPALLT
Ga0210394_1107441023300021420SoilIFAAGAIVGGLLFRRGPLRRDDGQAQQDAGAMAETEAGPALPA
Ga0210394_1161097213300021420SoilTAFWWIAGIFAGGAIVGGLLFRRGPLYRKDGQGQQAAGVMAGIEAGPALLT
Ga0210410_1166549113300021479SoilWIAGIFAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMAETDAGPALLA
Ga0207680_1045658223300025903Switchgrass RhizosphereGAIVGGLLFRRGPLRRDDAHVQQDAGVMAETEAGPVLPA
Ga0207685_1035694323300025905Corn, Switchgrass And Miscanthus RhizosphereAIVGGLLFRRGPLYRKDGQVQQDAGVMAQTEAGPALLP
Ga0207699_1013034313300025906Corn, Switchgrass And Miscanthus RhizosphereFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETKAGPVLPA
Ga0207684_1148582523300025910Corn, Switchgrass And Miscanthus RhizosphereGIFAGGAIVGGLLFRRGPLRRDDGQVQQDGGVMAETEAGPARPA
Ga0207654_1112115813300025911Corn RhizosphereLAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDDRVQQDAGVMAETEAGPVLPA
Ga0207695_1160712423300025913Corn RhizosphereIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA
Ga0207693_1100788213300025915Corn, Switchgrass And Miscanthus RhizosphereLAHGYDTAFLWIAGIFAGGAIVGGLLFRRGPLYRKDGQVQQDAGVMTGTEAGPALLA
Ga0207663_1163291823300025916Corn, Switchgrass And Miscanthus RhizosphereAGGAIVGGVLFRRGPLVRKDDQAQVTAMETEAGPALPA
Ga0207652_1123613813300025921Corn RhizosphereAHGYDIAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA
Ga0207694_1188828913300025924Corn RhizosphereALAHGYDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETEAGPVLPA
Ga0207700_1160124713300025928Corn, Switchgrass And Miscanthus RhizosphereDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGHVQQDAGVMAETDAGPVLPA
Ga0207700_1189054723300025928Corn, Switchgrass And Miscanthus RhizosphereGIFAGGAIVGGALFRRGPLVRKDDQAQVKAMETEAGPALPA
Ga0207665_1136081423300025939Corn, Switchgrass And Miscanthus RhizosphereAGIFAAGAIVGGLLFRRGPLYRKDGQGQQAAGVMAGTEAGPALLA
Ga0209804_110844313300026335SoilDTAFWWIAGIFAGGAIVGGLLFRRGPLYRKDSQVQQDAGVMTGTEAGPALLA
Ga0179593_104001513300026555Vadose Zone SoilFAVGAIVGGLLFRRGPLYRKDGRGQQAAGVMAGTEAGPALLA
Ga0209418_107194913300027371Forest SoilAHGYDTAFWWTAGILVGGAIVSGVLFRPGPLYRRDGQSPQDAGVLAQTEAGPAFPA
Ga0209180_1068497313300027846Vadose Zone SoilWWTAGILASGAIIGGALLRRGPLYRKDAPGQQAAGVEAAETKAGPAFPA
Ga0318515_1047074523300031572SoilYDTAFWWTAGILAGGAIVAGLLFRRGPLYRKDAQPQAAGVLAETEAGPALLT
Ga0318572_1029054613300031681SoilWWTAGILAGGAIVAGLLFRRGPLYRKDAQPQAAGVLAETEAGPALLT
Ga0306917_1013500013300031719SoilAGLLFRSGPLYRKDDQPQQAAGVLAETEAGPAFPA
Ga0307468_10102009713300031740Hardwood Forest SoilDVAFWWVAGIFAGGAIVGGLLFRRGPLRRDDGQVQQDTGVMAETEAGPVLPA
Ga0318521_1010228123300031770SoilAIVSGILFRPGPLYRRDGQPQQDAGVMARTEAGPAFPA
Ga0318567_1010423523300031821SoilGGLLFRRGPLYSKDAQPQQAAGVLAETEAGPALLT
Ga0318511_1018196513300031845SoilILAGGAIVAGLLFRRGPLYRTDAQTQQAAGVLAETEAGPALLT
Ga0306925_1022534413300031890SoilTAFWWTAGILVGGAIVSGILFRPGPLYRRDGQPQQDAGVMARTEAGPAFPA
Ga0306925_1046537013300031890SoilGAIVAGILFRPGPLYRKDSPAPQDTGVMATETEAGPALPA
Ga0306925_1171309113300031890SoilVVLAGGAIVAGLLFRPGPLYRKDSPARQDRGVMAAETEAGPALPA
Ga0318551_1084585013300031896SoilIAFWWTAVVLAGGAIVAGLLFRPGPLYRKDSPARQDRGVMAAETEAGPALPA
Ga0306923_1038499523300031910SoilLVGGAIVGGILFRPGPLYRRDGQPQQDAGVMARTEAGPAFPA
Ga0308175_10131673823300031938SoilGIFAGGAIVGGLLFRRGPLRRDDGQVQQDAGVTAETEAGPVLPA
Ga0310916_1090627623300031942SoilGAIVSGILFRPGPLYRRDGQPQQDAGVMARTEAGPAFPA
Ga0318569_1012853013300032010SoilYDTAFWWTAGILAGGAIVAGLLFRRGPLYRNDAQPQQAAGVLAETEAGPALLT
Ga0318510_1044765023300032064SoilAGILVGGAIVAGLLFRRGPLYSKDAQPQQAAGVLAETEAGPALLT
Ga0318524_1017559113300032067SoilFWWTAGILAGGAIVAGLLFRRGPLYRKDAQPQAAGVLAETEAGPALLT
Ga0318553_1012761623300032068SoilASAFWWTAGILAGGAIVAGLLFRRGPLYRKDAQPQAAGVLAETEAGPALLT
Ga0318518_1037074913300032090SoilGYDTAFWWTAGILAGGAVVAALLFRSGPLYRKDGQARQDTGVMAETEAGPVLPA
Ga0307470_1042302223300032174Hardwood Forest SoilGGLLFRRGPLRRDDGQVQQDAGVMAETEAGPVLPA
Ga0335079_1013527233300032783SoilYDAAFWWTAGILAGGAIVAGLLFRRGPLYRKDAQPQQAAGVLAETEAGPALLT
Ga0335083_1014807623300032954SoilGLALAHGYDTAFWWTAGILVGGAIVGGILFRPGPLYRRDGQPQQDAGVMAQTEAGPAFPA
Ga0335073_1021503713300033134SoilWWVAGIFAGGAIIGGLLFRRGPLRRDDGQVQQDAGVMADIEAGPVLPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.