NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087631

Metagenome / Metatranscriptome Family F087631

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087631
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 48 residues
Representative Sequence YGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA
Number of Associated Samples 90
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.36 %
% of genes from short scaffolds (< 2000 bps) 91.82 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(16.364 % of family members)
Environment Ontology (ENVO) Unclassified
(21.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.909 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.43%    β-sheet: 2.13%    Coil/Unstructured: 57.45%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00528BPD_transp_1 30.00
PF13191AAA_16 0.91
PF06897DUF1269 0.91
PF01087GalP_UDP_transf 0.91
PF00005ABC_tran 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.18 %
UnclassifiedrootN/A1.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig123692All Organisms → cellular organisms → Bacteria827Open in IMG/M
2170459005|F1BAP7Q01D41L0All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100236719All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300000956|JGI10216J12902_112745003All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300001538|A10PFW1_12123365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium tusciae532Open in IMG/M
3300001867|JGI12627J18819_10435313All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005172|Ga0066683_10453291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae786Open in IMG/M
3300005174|Ga0066680_10674031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium638Open in IMG/M
3300005174|Ga0066680_10780976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae577Open in IMG/M
3300005178|Ga0066688_10833603All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005186|Ga0066676_10385223All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300005332|Ga0066388_105108657All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005367|Ga0070667_100767913All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005435|Ga0070714_101221283All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005467|Ga0070706_100547370All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300005467|Ga0070706_101186492All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005471|Ga0070698_100578434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium1063Open in IMG/M
3300005518|Ga0070699_100321068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1392Open in IMG/M
3300005549|Ga0070704_102182732All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005552|Ga0066701_10323600All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005614|Ga0068856_102023208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium586Open in IMG/M
3300005617|Ga0068859_100847539All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300005764|Ga0066903_105359441All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005764|Ga0066903_105882223All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005764|Ga0066903_106211994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae624Open in IMG/M
3300005764|Ga0066903_107229453All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005764|Ga0066903_108717798All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005764|Ga0066903_108972961All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005841|Ga0068863_102299731All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005842|Ga0068858_102210207All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005842|Ga0068858_102602454All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005901|Ga0075274_1049687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae641Open in IMG/M
3300006028|Ga0070717_10517331All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300006028|Ga0070717_11098115All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006173|Ga0070716_101152178All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006175|Ga0070712_100299341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300006175|Ga0070712_100609894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae924Open in IMG/M
3300006175|Ga0070712_101619087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae566Open in IMG/M
3300006755|Ga0079222_12682479All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006804|Ga0079221_10329569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae911Open in IMG/M
3300006806|Ga0079220_11124703All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006871|Ga0075434_100662039All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300006903|Ga0075426_10214958All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300006903|Ga0075426_11323722All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300007258|Ga0099793_10359784All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300009137|Ga0066709_103261409All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009545|Ga0105237_11023918All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009551|Ga0105238_11424281All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300009792|Ga0126374_10428256All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300010048|Ga0126373_11888879All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010048|Ga0126373_12097776All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300010154|Ga0127503_10591351All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300010358|Ga0126370_11803453All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010361|Ga0126378_12922097All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010366|Ga0126379_11197093All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010376|Ga0126381_104153280All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010376|Ga0126381_104964975All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010376|Ga0126381_105023902All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010397|Ga0134124_10791620All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300012205|Ga0137362_11754622All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012210|Ga0137378_10785402All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300012211|Ga0137377_10858005All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300012356|Ga0137371_10619269All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300012357|Ga0137384_10153915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium1924Open in IMG/M
3300012917|Ga0137395_10495877All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300012960|Ga0164301_10488500All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012989|Ga0164305_11819296All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300014823|Ga0120170_1112487All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300017959|Ga0187779_10058318All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Bbin022263Open in IMG/M
3300017959|Ga0187779_10185792All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300017974|Ga0187777_10014035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5073Open in IMG/M
3300021086|Ga0179596_10201208All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300024245|Ga0247677_1043177All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300025906|Ga0207699_10076300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2064Open in IMG/M
3300025910|Ga0207684_10791386All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300025910|Ga0207684_11472130All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025915|Ga0207693_10181817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1655Open in IMG/M
3300025915|Ga0207693_10728800All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300025922|Ga0207646_11079564All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300025929|Ga0207664_10651980All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300025929|Ga0207664_11965484All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025935|Ga0207709_10176310All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300026358|Ga0257166_1045286All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300027646|Ga0209466_1007211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2354Open in IMG/M
3300027765|Ga0209073_10387537All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300030967|Ga0075399_11257983All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031231|Ga0170824_105295325All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031474|Ga0170818_111561046All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031561|Ga0318528_10055813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium2007Open in IMG/M
3300031713|Ga0318496_10513465All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300031724|Ga0318500_10130606All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300031736|Ga0318501_10658051All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300031765|Ga0318554_10498891All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300031769|Ga0318526_10392754All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031780|Ga0318508_1223554All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031781|Ga0318547_10936901All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031796|Ga0318576_10442911All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300031821|Ga0318567_10478141All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300031845|Ga0318511_10017251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2582Open in IMG/M
3300031890|Ga0306925_11124150All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300031941|Ga0310912_11504309All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032041|Ga0318549_10051881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium1694Open in IMG/M
3300032055|Ga0318575_10720314All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300032180|Ga0307471_100446917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium1431Open in IMG/M
3300032205|Ga0307472_102379792All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300032828|Ga0335080_10278219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1823Open in IMG/M
3300033004|Ga0335084_10043645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4617Open in IMG/M
3300033289|Ga0310914_10829021All Organisms → cellular organisms → Bacteria823Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere16.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.27%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.73%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300030967Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_111886002124908045SoilTTKSSYTGEPYVWPWLADAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSGVS
E41_082857102170459005Grass SoilKADPATLTTTNSYYGEPYVFPWLSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSA
INPhiseqgaiiFebDRAFT_10023671913300000364SoilEPYVFPWMSDAVVHEEDFHVGYFEEELTPAVDQLWHNAWQAFNSGVS*
JGI10216J12902_11274500323300000956SoilTLTTTNSYYGEPYVFPWLSDAVVHESDFQTGYFEEELTPQVDQLWHNAWQAFNSA*
A10PFW1_1212336513300001538PermafrostLTTTKNAYGVPYVFPWMSDAVVREEDFKTGRLELELTPGVDQLWHNAWQAFNAGVK*
JGI12627J18819_1043531323300001867Forest SoilVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA*
Ga0066683_1045329123300005172SoilTTAKSYYGVPYVFPWLSEAVLQESDFKTGKLELELTPTVDQAWHNVWQSFNAGVK*
Ga0066680_1067403123300005174SoilSAVVDESDFHTGYFEAELTPQVDQLWHNVWQAFNSGVSG*
Ga0066680_1078097623300005174SoilTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0066688_1083360323300005178SoilISAQGEPYVFPWLSDAIVRETDFTTGKLELELTPDVDSLWHDAWSQFQSG*
Ga0066676_1038522313300005186SoilSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHHAWQAFNSA*
Ga0066388_10510865713300005332Tropical Forest SoilGEPYIFPWLSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0070667_10076791323300005367Switchgrass RhizosphereDPETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0070714_10122128313300005435Agricultural SoilFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0070706_10054737023300005467Corn, Switchgrass And Miscanthus RhizosphereFYGEPYVFPWMSDAVVHESDFHIGYFEEELTPQVDQLWHNAWQAFNSGVS*
Ga0070706_10118649213300005467Corn, Switchgrass And Miscanthus RhizospherePYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0070698_10057843423300005471Corn, Switchgrass And Miscanthus RhizosphereYVFPWLSDAVVRESDFHTGRLELELTPQVDQQWHNVWQAFNAGVG*
Ga0070698_10134771613300005471Corn, Switchgrass And Miscanthus RhizosphereADPATLTTTKSYYGVPYVFPWMKDAVVYESDFKTGYFEEELTPSVDTLWHNAWQGFNSGVS*
Ga0070699_10032106813300005518Corn, Switchgrass And Miscanthus RhizosphereDPATLTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0070704_10218273223300005549Corn, Switchgrass And Miscanthus RhizosphereTLTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA*
Ga0066701_1032360023300005552SoilDESDFHTGYFEAELTPQVDQLWHNVWQAFNSGVSG*
Ga0068856_10202320813300005614Corn RhizosphereTKSAYGEPYVFPWMSDAVVRESDFSIGYFEEELTPQVDQLWHNVWQAFNSG*
Ga0068859_10084753923300005617Switchgrass RhizosphereGEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0066903_10535944123300005764Tropical Forest SoilFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0066903_10588222323300005764Tropical Forest SoilTNGYYGEPYVFPWLSDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0066903_10621199423300005764Tropical Forest SoilPWLSDAVVHEADFHTGYFEEELTPQVDALWHNAWQAFNSA*
Ga0066903_10722945323300005764Tropical Forest SoilAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0066903_10871779813300005764Tropical Forest SoilYGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0066903_10897296123300005764Tropical Forest SoilYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0068863_10229973123300005841Switchgrass RhizosphereVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0068858_10221020723300005842Switchgrass RhizosphereVVRESDFQVGYFIEELTPQVDQLWHNAWQAFNSA*
Ga0068858_10260245413300005842Switchgrass RhizosphereTTTNSYYGEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0075274_104968713300005901Rice Paddy SoilTLTTTNGFYGEPYVFPWMSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSGVS*
Ga0070717_1051733123300006028Corn, Switchgrass And Miscanthus RhizosphereTLTTTKSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA*
Ga0070717_1109811513300006028Corn, Switchgrass And Miscanthus RhizosphereEPYVFPWLSDAVVRESDFHTGYFEEELTPRVDQLWHNAWQAFNSA*
Ga0070716_10115217813300006173Corn, Switchgrass And Miscanthus RhizosphereSYYGEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0070712_10029934113300006175Corn, Switchgrass And Miscanthus RhizosphereFPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA*
Ga0070712_10060989413300006175Corn, Switchgrass And Miscanthus RhizosphereETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0070712_10161908713300006175Corn, Switchgrass And Miscanthus RhizosphereLTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0079222_1268247923300006755Agricultural SoilDAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0079221_1032956913300006804Agricultural SoilDPATLTTTNSYFGEPYVFPWLSDAVVHDSDFHTGYFQEELTPQVDALWHNAWQAFNSG*
Ga0079220_1112470323300006806Agricultural SoilVVHEEDFHVGYFEEELTPSVDQLWHNAWQAFNSGVS*
Ga0075434_10066203913300006871Populus RhizosphereVFPWLSDAVVHEEDFHVGYFEEELTPTVDQLWHNAWQAFNSGVS*
Ga0075426_1021495813300006903Populus RhizosphereFPWLSDAVVHEEDFHVGYFEEELTPTVDQLWHNAWQAFNSGVS*
Ga0075426_1132372223300006903Populus RhizosphereSYYGEPYVFPWLSDAVVDESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0099793_1035978423300007258Vadose Zone SoilGEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS*
Ga0066709_10326140923300009137Grasslands SoilVFPWMSSAVVDESDFHTGDFEAELTPQVDQLWHNVWQAFNSGVSG*
Ga0105237_1102391813300009545Corn RhizosphereTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0105238_1142428113300009551Corn RhizosphereAVVRESDFQVGYFIEELTPQVDQLWHNAWQAFNSA*
Ga0126374_1042825623300009792Tropical Forest SoilVFPWLSDAVVFEKDFHSGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0126373_1188887923300010048Tropical Forest SoilTLTTTKSYYGEPYVFPWLSDAVVRESDFHTGFFEEELTPQVDQRWHNAWQAFNSA*
Ga0126373_1209777613300010048Tropical Forest SoilSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0127503_1059135113300010154SoilEPYVFPWLSDAVVHESDFHTGYFQEELTPAVDHLWHNAWQAFNSA*
Ga0126370_1180345313300010358Tropical Forest SoilYGEPYVFPWLSDAVVHESDFHTGYFQEELTPTVDQLWHNAWQAFNSA*
Ga0126378_1292209723300010361Tropical Forest SoilSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0126379_1119709323300010366Tropical Forest SoilYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0126381_10415328023300010376Tropical Forest SoilDAVVHESDFHTGFFEEELTPQVDQLWHNAWQAFNSA*
Ga0126381_10496497523300010376Tropical Forest SoilSDAVVRESDFHTGYFEEELTPQIDQLWHNAWQAFNSGVS*
Ga0126381_10502390223300010376Tropical Forest SoilYGEPYVFPWLSDAVVHESDFRTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0134124_1079162023300010397Terrestrial SoilYVFPWLSDAVVRESDFHTGYFQEELTPQVDGLWHNAWQVFNSA*
Ga0137362_1175462213300012205Vadose Zone SoilYGEPYVFPWLSDAIVYETDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS*
Ga0137378_1078540223300012210Vadose Zone SoilATLTTTSSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0137377_1085800513300012211Vadose Zone SoilLTTTSSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0137371_1061926913300012356Vadose Zone SoilVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA*
Ga0137384_1015391513300012357Vadose Zone SoilLTTTNGFYQEPYVFPWMSDAVVHESDFHTGYFEEELTPAVDQLWHNAWQAFNSGVS*
Ga0137395_1049587713300012917Vadose Zone SoilTPTTTKNYYGEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS*
Ga0164301_1048850023300012960SoilTTTNSYYGEPYVFPWLSDAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0164305_1181929613300012989SoilKNYYGEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSA*
Ga0157372_1105716813300013307Corn RhizosphereRKADPETLTTTKSYYGEPYVFPWLSDAVVRETDFHTGYFEEELTPQVDQLWHNAWQAFNSA*
Ga0120170_111248723300014823PermafrostPYVFPWMSDAVVREEDFKTGRLELELTPGVDQLWHNAWQAFNAGVK*
Ga0187779_1005831813300017959Tropical PeatlandENAYGVPYVFPWMSDAVIRESDFHTGREELELTPATDVLWHNAWQGFTAGAK
Ga0187779_1018579233300017959Tropical PeatlandYGVPYVFPWMSDAVIRESDFRTGREELELTPATDVLWHDAWQGFTAGAK
Ga0187777_1001403513300017974Tropical PeatlandPYVFPWMSDAVIRESDFHTGREELELTPATDVLWHNAWQGFTAGAK
Ga0179596_1020120813300021086Vadose Zone SoilLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0247677_104317723300024245SoilNSYYGEPYVFPWLSDAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA
Ga0207699_1007630013300025906Corn, Switchgrass And Miscanthus RhizosphereDAIVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0207684_1079138613300025910Corn, Switchgrass And Miscanthus RhizosphereTLTTTKSYYGVPYVFPWMKDAVVYESDFKTGYFEEELTPSVDTLWHNAWQGFNSGVS
Ga0207684_1147213013300025910Corn, Switchgrass And Miscanthus RhizosphereAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0207693_1018181713300025915Corn, Switchgrass And Miscanthus RhizosphereTLTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0207693_1072880013300025915Corn, Switchgrass And Miscanthus RhizosphereETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA
Ga0207646_1107956413300025922Corn, Switchgrass And Miscanthus RhizosphereSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0207664_1065198023300025929Agricultural SoilPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA
Ga0207664_1196548413300025929Agricultural SoilTTLTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0207709_1017631023300025935Miscanthus RhizospherePYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0257166_104528613300026358SoilLTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA
Ga0209466_100721113300027646Tropical Forest SoilTTTNGYYGEPYVWPWLSDAVVHESDFQTGYFQEELTPQVDRLWHNAWQAFNSA
Ga0209073_1038753713300027765Agricultural SoilNSYFGEPYVFPWLSDAVVRDSDFHTGYFEEELTPQVDALWHNAWQAFNSG
Ga0075399_1125798313300030967SoilYYGVPYVFPWLTDAIVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA
Ga0170824_10529532513300031231Forest SoilPYVFPWLKDAIVYESDFHTGYFEEELTPQVDGLWHNAWQAFTAGVS
Ga0170818_11156104613300031474Forest SoilSYYGEPYVFPWLSDAVVHESDFHTGHFQEELTPQVDQLWHNAWQAFNSA
Ga0318528_1005581333300031561SoilSDAVVQESDFRTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0318496_1051346523300031713SoilTTNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG
Ga0318500_1013060633300031724SoilEPYVFPWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA
Ga0318501_1065805113300031736SoilADPATLTTTNSAYGEPYVFPWMPDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA
Ga0318554_1049889123300031765SoilEPYVFPWMSDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA
Ga0318526_1039275423300031769SoilPWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA
Ga0318508_122355423300031780SoilTTKGYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG
Ga0318547_1093690113300031781SoilEPYVFPWLSDAVVQESDFRTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0318576_1044291113300031796SoilWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG
Ga0318567_1047814113300031821SoilADPTTLTTTKSYYGEPYVFPWMTDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA
Ga0318511_1001725143300031845SoilYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG
Ga0306925_1112415023300031890SoilTNGYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG
Ga0310912_1150430913300031941SoilWLSDAVVHESDFHTGYFEEELTPAVDQLWHNAWQAFNSA
Ga0318549_1005188133300032041SoilRQADPATLTTTNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNS
Ga0318575_1072031413300032055SoilTNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG
Ga0307471_10044691713300032180Hardwood Forest SoilDPATLTTTNSYYGEPYVFPWMSDAVVDESDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0307472_10237979213300032205Hardwood Forest SoilSTLTTTNSYYGEPYVFPWLPDAIMHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA
Ga0335080_1027821933300032828SoilTLTTTQNAYGVPYVFPWMSDAVIRESDFHTGLEELELTPATDVLWHNAWQGFTAGAK
Ga0335084_1004364513300033004SoilVDTLTTTKTVYGLPYVFPWMPDAVVREDDFQQGLVAGELTPQVDAQWRNVWQAFKSGRS
Ga0310914_1082902113300033289SoilSYYGEPYVFPWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.