NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087627

Metagenome / Metatranscriptome Family F087627

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087627
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 48 residues
Representative Sequence MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA
Number of Associated Samples 95
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.27 %
% of genes near scaffold ends (potentially truncated) 42.73 %
% of genes from short scaffolds (< 2000 bps) 81.82 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.545 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(24.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.091 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 12.24%    Coil/Unstructured: 87.76%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF12706Lactamase_B_2 38.18
PF11845DUF3365 10.00
PF03070TENA_THI-4 7.27
PF09900DUF2127 1.82
PF04055Radical_SAM 1.82
PF01740STAS 1.82
PF02277DBI_PRT 0.91
PF13186SPASM 0.91
PF05402PqqD 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2038NaMN:DMB phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.55 %
UnclassifiedrootN/A5.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0610286All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis596Open in IMG/M
3300000953|JGI11615J12901_10361343All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300001431|F14TB_104499443Not Available742Open in IMG/M
3300003993|Ga0055468_10009010All Organisms → cellular organisms → Bacteria → Proteobacteria1856Open in IMG/M
3300003996|Ga0055467_10015897All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300004798|Ga0058859_11309649All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005290|Ga0065712_10312194All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300005328|Ga0070676_10115179All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300005332|Ga0066388_101839496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae1078Open in IMG/M
3300005337|Ga0070682_100795106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae768Open in IMG/M
3300005344|Ga0070661_101412818Not Available586Open in IMG/M
3300005347|Ga0070668_100316448All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300005364|Ga0070673_102356389All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005438|Ga0070701_10156658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae1316Open in IMG/M
3300005445|Ga0070708_100909871All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005458|Ga0070681_10109899All Organisms → cellular organisms → Bacteria → Proteobacteria2696Open in IMG/M
3300005547|Ga0070693_100112210All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300005713|Ga0066905_100187012All Organisms → cellular organisms → Bacteria → Proteobacteria1534Open in IMG/M
3300005764|Ga0066903_107027578All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300005937|Ga0081455_10004907All Organisms → cellular organisms → Bacteria14823Open in IMG/M
3300005937|Ga0081455_10488813All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300006049|Ga0075417_10382574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae694Open in IMG/M
3300006049|Ga0075417_10472253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae628Open in IMG/M
3300006058|Ga0075432_10021374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae2212Open in IMG/M
3300006173|Ga0070716_101327644All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300006358|Ga0068871_101833894All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300006804|Ga0079221_10295728All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006806|Ga0079220_11314006All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006844|Ga0075428_100800892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae1001Open in IMG/M
3300006852|Ga0075433_10443385All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300006852|Ga0075433_11928470All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006854|Ga0075425_100405812All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300006854|Ga0075425_100552389All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300006854|Ga0075425_101150483All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300006854|Ga0075425_102886538Not Available527Open in IMG/M
3300006871|Ga0075434_100125611All Organisms → cellular organisms → Bacteria → Proteobacteria2582Open in IMG/M
3300006871|Ga0075434_100338005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae1526Open in IMG/M
3300006903|Ga0075426_10853681All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006954|Ga0079219_10402378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae908Open in IMG/M
3300006954|Ga0079219_12530069All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300009094|Ga0111539_10210341All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium2267Open in IMG/M
3300010359|Ga0126376_10559616All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300010362|Ga0126377_11720749All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis702Open in IMG/M
3300010371|Ga0134125_11520648All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis729Open in IMG/M
3300010371|Ga0134125_11857311All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300010371|Ga0134125_12031327Not Available625Open in IMG/M
3300010373|Ga0134128_11820037Not Available670Open in IMG/M
3300010398|Ga0126383_12189462All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis639Open in IMG/M
3300010401|Ga0134121_12003623All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis611Open in IMG/M
3300012884|Ga0157300_1040641All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium699Open in IMG/M
3300012901|Ga0157288_10003045All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis2236Open in IMG/M
3300012906|Ga0157295_10398807All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012909|Ga0157290_10028045All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira1298Open in IMG/M
3300012915|Ga0157302_10373880All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012948|Ga0126375_10170742All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1395Open in IMG/M
3300012955|Ga0164298_10672576All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis722Open in IMG/M
3300012958|Ga0164299_10745991All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis691Open in IMG/M
3300012960|Ga0164301_10603187Not Available811Open in IMG/M
3300012961|Ga0164302_10032885All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira2403Open in IMG/M
3300012961|Ga0164302_11134874All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300012984|Ga0164309_10179357All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1438Open in IMG/M
3300012986|Ga0164304_11788187All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012987|Ga0164307_10082253All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1961Open in IMG/M
3300012988|Ga0164306_10191287All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1429Open in IMG/M
3300012989|Ga0164305_11383370All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis619Open in IMG/M
3300014259|Ga0075311_1045424All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300014268|Ga0075309_1037731All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1079Open in IMG/M
3300014310|Ga0075331_1050055All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.936Open in IMG/M
3300014325|Ga0163163_12559861All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300014745|Ga0157377_10047380All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis2408Open in IMG/M
3300015077|Ga0173483_10002631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae5915Open in IMG/M
3300015371|Ga0132258_10462604All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis3165Open in IMG/M
3300015372|Ga0132256_103320119All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis541Open in IMG/M
3300015373|Ga0132257_100521529All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1460Open in IMG/M
3300019361|Ga0173482_10204943All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis810Open in IMG/M
3300019362|Ga0173479_10212421All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300022892|Ga0247753_1047854All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis544Open in IMG/M
3300025559|Ga0210087_1082164All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis637Open in IMG/M
3300025795|Ga0210114_1120095All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis527Open in IMG/M
3300025796|Ga0210113_1055852All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis791Open in IMG/M
3300025893|Ga0207682_10011596All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis3443Open in IMG/M
3300025901|Ga0207688_10044271All Organisms → cellular organisms → Bacteria2480Open in IMG/M
3300025911|Ga0207654_10164098All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1437Open in IMG/M
3300025918|Ga0207662_10071628All Organisms → cellular organisms → Bacteria2099Open in IMG/M
3300025934|Ga0207686_11146891All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300025940|Ga0207691_10068772All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis3199Open in IMG/M
3300025940|Ga0207691_10461052All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1081Open in IMG/M
3300025940|Ga0207691_10461053All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300025941|Ga0207711_12056008All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis514Open in IMG/M
3300025942|Ga0207689_10089888All Organisms → cellular organisms → Bacteria2523Open in IMG/M
3300025944|Ga0207661_10885397All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium822Open in IMG/M
3300025944|Ga0207661_11805013All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300026062|Ga0208654_1050442All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300026118|Ga0207675_100118477All Organisms → cellular organisms → Bacteria2504Open in IMG/M
3300026121|Ga0207683_10464431All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1167Open in IMG/M
3300027252|Ga0209973_1031769All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis747Open in IMG/M
3300027360|Ga0209969_1000337All Organisms → cellular organisms → Bacteria → Proteobacteria6270Open in IMG/M
3300027364|Ga0209967_1002233All Organisms → cellular organisms → Bacteria → Acidobacteria2514Open in IMG/M
3300027462|Ga0210000_1031026All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300027471|Ga0209995_1000339All Organisms → cellular organisms → Bacteria7328Open in IMG/M
3300027873|Ga0209814_10269575All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis739Open in IMG/M
3300028587|Ga0247828_10398900All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium791Open in IMG/M
3300031908|Ga0310900_11410691All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira585Open in IMG/M
3300031943|Ga0310885_10055241All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1664Open in IMG/M
3300032000|Ga0310903_10711395All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300032003|Ga0310897_10420878All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira635Open in IMG/M
3300032013|Ga0310906_10411170All Organisms → cellular organisms → Bacteria → Nitrospirae896Open in IMG/M
3300032017|Ga0310899_10563994All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300033412|Ga0310810_10213853All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis2163Open in IMG/M
3300033412|Ga0310810_11096249All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira663Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.18%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.36%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.55%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.64%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014310Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_061028622228664021SoilMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA
JGI11615J12901_1036134323300000953SoilNMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA*
F14TB_10449944313300001431SoilMSAEIGGYQDDFDERGSKPEEVVRSSDDPQSVPNVA*
Ga0055468_1000901023300003993Natural And Restored WetlandsMATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA*
Ga0055467_1001589723300003996Natural And Restored WetlandsMATWTTPTYTEISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA*
Ga0058859_1130964913300004798Host-AssociatedEINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA*
Ga0065712_1031219423300005290Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA*
Ga0070676_1011517923300005328Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA*
Ga0066388_10183949623300005332Tropical Forest SoilMITWTTPTYTEINMSAEIGGYQDEFDERGSKPEDTIRTSEAPQSVPKEA*
Ga0070682_10079510613300005337Corn RhizosphereVSRARTIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA*
Ga0070661_10141281813300005344Corn RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDLQSVPNVA*
Ga0070668_10031644823300005347Switchgrass RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDSQSVPNVA*
Ga0070673_10235638913300005364Switchgrass RhizosphereMATWTTPTYSEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSFPKEA*
Ga0070701_1015665823300005438Corn, Switchgrass And Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0070708_10090987113300005445Corn, Switchgrass And Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDD
Ga0070681_1010989923300005458Corn RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTSDDPQSVPNVA*
Ga0070693_10011221023300005547Corn, Switchgrass And Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA*
Ga0066905_10018701213300005713Tropical Forest SoilMSTWTTPTYTEINMSAEIGGYQDEFDERGSKPEDTIRTSEAPQSVPKEA*
Ga0066903_10702757823300005764Tropical Forest SoilMITWTTPTYTEINMSAEIGGYQDEFDERGLKPEDTIRTSEAPQSVPKEA*
Ga0081455_10004907123300005937Tabebuia Heterophylla RhizosphereMNWEKPAYREVNMSAEIGGYQDDFDERGSKPEDTIRTGDAPQSVPKEA*
Ga0081455_1048881313300005937Tabebuia Heterophylla RhizosphereMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRTNDAPQSLPKEA*
Ga0075417_1038257423300006049Populus RhizosphereLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0075417_1047225313300006049Populus RhizosphereELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA*
Ga0075432_1002137413300006058Populus RhizosphereELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA*
Ga0070716_10132764423300006173Corn, Switchgrass And Miscanthus RhizosphereMITWTTPTYTEINMSAEIGGYQDDFDERNAKPEEAIRTVDDPQSVPNVA*
Ga0068871_10183389423300006358Miscanthus RhizosphereMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0079221_1029572823300006804Agricultural SoilMNWEKPEYREVNMSAEIGGYQDDFDERTPKPDDTIRTADASRSVPTEA*
Ga0079220_1131400613300006806Agricultural SoilMIWTTPTYIEINMSAEIGGYQDDFDERNAKPEEVVRTVDDPQSVPNVA*
Ga0075428_10080089223300006844Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA*
Ga0075433_1044338533300006852Populus RhizosphereEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA*
Ga0075433_1192847013300006852Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEV
Ga0075425_10040581223300006854Populus RhizosphereMATWTTPTYSEINMSAEIGGYQDDFDERIPKPEDAIRTNDAPQSLPKEA*
Ga0075425_10055238923300006854Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTADDPQSVPNVA*
Ga0075425_10115048323300006854Populus RhizosphereMATWTTPTYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA*
Ga0075425_10288653813300006854Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRT
Ga0075434_10012561133300006871Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSNPEEVVRTGDDPQSVPNVA*
Ga0075434_10033800523300006871Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDPQSVPNVA*
Ga0075426_1085368123300006903Populus RhizosphereMATWTTPTYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA*
Ga0079219_1040237823300006954Agricultural SoilMKTWTTPAYTEINMSAEIGGYQDDFDERAPRPDDAIRRSEAPQSQPNEA*
Ga0079219_1253006923300006954Agricultural SoilMATWTTPSYSEINMSAEIGGYQDDFDERIPKPDDAIRTNNAPQSLPKEA*
Ga0111539_1021034113300009094Populus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDP
Ga0126376_1055961623300010359Tropical Forest SoilEINMSAEIGGYQDEFDERGSQHEDTIRTSEAPQSVPKEA*
Ga0126377_1172074923300010362Tropical Forest SoilMATWTTPTYTEINMSAEIGGYQDDFDERTPKPDNAIRTNDAPQSVPKEA*
Ga0134125_1152064823300010371Terrestrial SoilMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA*
Ga0134125_1185731113300010371Terrestrial SoilTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0134125_1203132723300010371Terrestrial SoilMVTWTTPAYTEINMSAEIGGYLDDFEERGSKPEEVVRTGDDSQSVPNVA*
Ga0134128_1182003723300010373Terrestrial SoilMVIWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDD
Ga0126383_1218946213300010398Tropical Forest SoilMITWTTPTYTEINMSAEIGGYQDEFDERGSQPEDTIRTSEAPQSVPKEA*
Ga0134121_1200362323300010401Terrestrial SoilFMFTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0157300_104064113300012884SoilMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVR
Ga0157288_1000304513300012901SoilVFIVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0157295_1039880713300012906SoilVELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA*
Ga0157290_1002804513300012909SoilMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVV
Ga0157302_1037388023300012915SoilYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA*
Ga0126375_1017074223300012948Tropical Forest SoilMITWTTPTYTEINMSAEIGGYQDEFDERGAKPEDTIRMNEAPQSVPKEA*
Ga0164298_1067257623300012955SoilMIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGEHPQSVPNEA*
Ga0164299_1074599113300012958SoilMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSFPKEA*
Ga0164301_1060318723300012960SoilMIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSVPNEA*
Ga0164302_1003288533300012961SoilMITWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTVDDPQSVPNVA*
Ga0164302_1113487423300012961SoilEINMSAEIGGYQDDFEERAPRPEDAIRPDDDPQSLPNEA*
Ga0164309_1017935723300012984SoilMIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPRSVPNEA*
Ga0164304_1178818713300012986SoilMIWTTPAYTEINMSAEIGGYQDDFDERNPKPEEAIRTGEGPQSFPNEA*
Ga0164307_1008225333300012987SoilMIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGEGPQSVPNEA*
Ga0164306_1019128723300012988SoilMIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSVPNKA*
Ga0164305_1138337023300012989SoilMITWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSLPNKA*
Ga0075311_104542413300014259Natural And Restored WetlandsEISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA*
Ga0075309_103773123300014268Natural And Restored WetlandsMATWTTPTYTEINMSAEIGGYQDDFDERIPKPEDAIRPGDDPQSIPNEA*
Ga0075331_105005513300014310Natural And Restored WetlandsMATWTTPTYTEINMSAEIGGYQDDFDERLPKPEDAIRPGDDPQSIPNEA*
Ga0163163_1255986113300014325Switchgrass RhizosphereAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVLNVA*
Ga0157377_1004738043300014745Miscanthus RhizosphereVELARGVLMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA*
Ga0173483_1000263113300015077SoilMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEQVVRTGDDSQSVPNVA*
Ga0132258_1046260423300015371Arabidopsis RhizosphereMITWTTPTYTEINMSAEIGGYQDDFDERNSKPEEAIRTVDDPQSVPNVA*
Ga0132256_10332011913300015372Arabidopsis RhizosphereREHVEIPMATWTTPTYSEINMSAEIGGYQDDFDERIPKPDDAIRTNNAPQSLPKEA*
Ga0132257_10052152913300015373Arabidopsis RhizosphereTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDRQSVPNVA*
Ga0173482_1020494323300019361SoilMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTSDDPQSVPNVA
Ga0173479_1021242123300019362SoilMVTWPTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA
Ga0247753_104785413300022892SoilMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0210087_108216423300025559Natural And Restored WetlandsMATWTTPTYTEISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA
Ga0210114_112009523300025795Natural And Restored WetlandsATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA
Ga0210113_105585223300025796Natural And Restored WetlandsMATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA
Ga0207682_1001159633300025893Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDLQSVPNVA
Ga0207688_1004427123300025901Corn, Switchgrass And Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA
Ga0207654_1016409823300025911Corn RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVLNVA
Ga0207662_1007162853300025918Switchgrass RhizosphereEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0207686_1114689113300025934Miscanthus RhizosphereTIPHSTIPIELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA
Ga0207691_1006877253300025940Miscanthus RhizosphereNMSAEIGGYQDEFEERVPKRDDAIHTVDAPPSVADEA
Ga0207691_1046105213300025940Miscanthus RhizosphereIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0207691_1046105313300025940Miscanthus RhizosphereIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA
Ga0207711_1205600813300025941Switchgrass RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDSQSVPNVA
Ga0207689_1008988823300025942Miscanthus RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA
Ga0207661_1088539723300025944Corn RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNV
Ga0207661_1180501323300025944Corn RhizosphereARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA
Ga0208654_105044213300026062Natural And Restored WetlandsEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA
Ga0207675_10011847713300026118Switchgrass RhizosphereAMKWETPAFVEINMSAEIGGYKHDFAERGSKPEEIVRTSDDPQSVPNVA
Ga0207683_1046443123300026121Miscanthus RhizosphereMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA
Ga0209973_103176923300027252Arabidopsis Thaliana RhizosphereDPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0209969_100033753300027360Arabidopsis Thaliana RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA
Ga0209967_100223323300027364Arabidopsis Thaliana RhizosphereMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDPQSVPNVA
Ga0210000_103102613300027462Arabidopsis Thaliana RhizosphereSTIPIELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNV
Ga0209995_1000339123300027471Arabidopsis Thaliana RhizospherePPSAIPVELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA
Ga0209814_1026957523300027873Populus RhizosphereMATWTTPTYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA
Ga0247828_1039890013300028587SoilMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDP
Ga0310900_1141069113300031908SoilMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMN
Ga0310885_1005524113300031943SoilSRARTIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0310903_1071139513300032000SoilARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA
Ga0310897_1042087813300032003SoilMATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRTNDAPQSLPKEA
Ga0310906_1041117023300032013SoilMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDPQSVPNVA
Ga0310899_1056399423300032017SoilINMSAEIGGYQDDFDERIPKPDDSIRTNDAPQSLPKEA
Ga0310810_1021385353300033412SoilGDLMKTWTTPAYTEINMSAEIGGYQDDFDERAPRPDDAIRRSEAPQSQPNEA
Ga0310810_1109624913300033412SoilMATWTTPTYSEINMSAEIGGYQDDFDERIPKPEDAIRTNDAPQSLPKEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.