NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087624

Metagenome Family F087624

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087624
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 41 residues
Representative Sequence ESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Number of Associated Samples 95
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.91 %
% of genes from short scaffolds (< 2000 bps) 0.91 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (99.091 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.909 % of family members)
Environment Ontology (ENVO) Unclassified
(44.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.81%    β-sheet: 0.00%    Coil/Unstructured: 61.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF06197DUF998 9.09
PF05147LANC_like 3.64
PF05988DUF899 3.64
PF08448PAS_4 3.64
PF00903Glyoxalase 2.73
PF08031BBE 2.73
PF01872RibD_C 2.73
PF13847Methyltransf_31 2.73
PF00174Oxidored_molyb 1.82
PF02566OsmC 1.82
PF13649Methyltransf_25 1.82
PF08241Methyltransf_11 1.82
PF07883Cupin_2 1.82
PF04237YjbR 1.82
PF13191AAA_16 0.91
PF00501AMP-binding 0.91
PF04993TfoX_N 0.91
PF01242PTPS 0.91
PF12802MarR_2 0.91
PF13602ADH_zinc_N_2 0.91
PF02371Transposase_20 0.91
PF02683DsbD 0.91
PF00248Aldo_ket_red 0.91
PF13671AAA_33 0.91
PF00664ABC_membrane 0.91
PF13463HTH_27 0.91
PF14269Arylsulfotran_2 0.91
PF02735Ku 0.91
PF00210Ferritin 0.91
PF00246Peptidase_M14 0.91
PF05544Pro_racemase 0.91
PF08240ADH_N 0.91
PF07690MFS_1 0.91
PF08734GYD 0.91
PF10431ClpB_D2-small 0.91
PF06772LtrA 0.91
PF00126HTH_1 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG3371Uncharacterized membrane proteinFunction unknown [S] 9.09
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 3.64
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 3.64
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.73
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 2.73
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.73
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 1.82
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 1.82
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 1.82
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 1.82
COG3915Uncharacterized conserved proteinFunction unknown [S] 1.82
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.91
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 0.91
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.91
COG3547TransposaseMobilome: prophages, transposons [X] 0.91
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.91
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.91
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A99.09 %
All OrganismsrootAll Organisms0.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005365|Ga0070688_100208110All Organisms → cellular organisms → Bacteria1372Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.36%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.82%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.91%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25406J46586_1019791023300003203Tabebuia Heterophylla RhizosphereETANVWVPHLVVGLAAIFLGLTTVQRGGYSYRKRPAAAAG*
Ga0063356_10246956713300004463Arabidopsis Thaliana RhizosphereVSPWLFGFADEGANAWAPFVVVRLAAVVLGLTTKQRGRDSYRKTPAAT*
Ga0062595_10146587813300004479SoilFGFADDPANVWIWFVVVGLAAIFLGLTTRQSGGYSYGRAEHPAIG*
Ga0070690_10014644513300005330Switchgrass RhizosphereNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070670_10108774413300005331Switchgrass RhizosphereWLFGFADEGANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070660_10011065833300005339Corn RhizosphereFGFADNSANVWVPHLVVGLAAIFLGLTTVQQGGYSYRTASTAH*
Ga0070689_10033591113300005340Switchgrass RhizosphereGANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070692_1052123613300005345Corn, Switchgrass And Miscanthus RhizosphereESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070688_10020811033300005365Switchgrass RhizosphereADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG*
Ga0070688_10035336723300005365Switchgrass RhizospherePWLFGFADEGANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070711_10057483033300005439Corn, Switchgrass And Miscanthus RhizosphereESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG*
Ga0070662_10079262823300005457Corn RhizosphereGANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0066697_1030044823300005540SoilFGFADETANVWLPHLIVGLAAVFLGLTTKQGGYSYRKVDTPRAAIG*
Ga0070672_10117050813300005543Miscanthus RhizosphereFADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG*
Ga0070704_10098865733300005549Corn, Switchgrass And Miscanthus RhizosphereDESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0066905_10133479513300005713Tropical Forest SoilFGFADESANVWVPFVVVGIAAIVLGLTTKQQGGYSYRKPTAATP*
Ga0068870_1063463223300005840Miscanthus RhizosphereWLPHVVVGLAATFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0075432_1041511213300006058Populus RhizosphereESANVWVPHVIVGLAATFLGLTTVQRAGYSYRKRTTPTTAAG*
Ga0070716_10139950313300006173Corn, Switchgrass And Miscanthus RhizospherePHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070712_10145920613300006175Corn, Switchgrass And Miscanthus RhizosphereNVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG*
Ga0075422_1038791113300006196Populus RhizosphereAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0066659_1048475023300006797SoilFGFADETANVWLPHLIVGLAAVFLGLTTKQQGGYSYRKADTPRTAIG*
Ga0066660_1134274023300006800SoilGFADDSANVWVPHLVVGLAAVFLGLTTKQQGGYGYRKVDTPSAAVG*
Ga0075431_10012256463300006847Populus RhizosphereEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0075433_1147621413300006852Populus RhizosphereADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG*
Ga0075425_10216741923300006854Populus RhizosphereAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG*
Ga0075425_10222679523300006854Populus RhizosphereFADEGANAWLPLVVVGVAAIFLGLTTKQRGGYSYRRRDAAGTAA*
Ga0075424_10162150413300006904Populus RhizosphereVWVPHVVVGLAAVFLGLTTIQQGYSYRRSGATTAAG*
Ga0075424_10186373013300006904Populus RhizosphereWVPFVVIGLAAIFLGLTTKQAGGYRYGTSPRTTATG*
Ga0066710_10446063513300009012Grasslands SoilNVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAEPRSAAVG
Ga0105245_1028741843300009098Miscanthus RhizosphereNVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0075418_1064361023300009100Populus RhizosphereFADDGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA*
Ga0105247_1125479423300009101Switchgrass RhizosphereLFGFADEGANFWVPFVVIGGAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0111538_1411855023300009156Populus RhizosphereANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0075423_1026462233300009162Populus RhizosphereFWVPFVVIGLAAIFLGLTTKQVGGYRYGTSPRTTATG*
Ga0075423_1227297633300009162Populus RhizosphereVVGLAAIFLGLTTKQQGGYSYRKSGTRTPTTASL*
Ga0075423_1312515023300009162Populus RhizosphereDESANVWVPHLVVGLVAVFLGLTTIQQGYSYRRSGATTAAG*
Ga0105242_1007861043300009176Miscanthus RhizosphereDPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG*
Ga0105248_1283000913300009177Switchgrass RhizosphereDESANVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0105238_1175715413300009551Corn RhizosphereSANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH*
Ga0105340_132386813300009610SoilADESASVWLPHVVVGLAAIFLGLTTKQRGGYRYGRHTDAASTSVG*
Ga0126304_1039599423300010037Serpentine SoilADESANVWAPHVVVGLAAIFLGLTTVQRGYSYRKTTTPTTAAG*
Ga0126382_1108398923300010047Tropical Forest SoilNFWLPFVVIGVAAIFLGFTTKQQGGYSYGKTSTPTTA*
Ga0126382_1227830013300010047Tropical Forest SoilDEGPNAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0134125_1201322013300010371Terrestrial SoilESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0134126_1049617113300010396Terrestrial SoilETANVWAPFVVIGLAAVFLGLTTKQVGGYSYRRRPTAATG*
Ga0134123_1081124823300010403Terrestrial SoilVWVPHVAVGLAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0137393_1062766413300011271Vadose Zone SoilASVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAETPRTAIG*
Ga0120163_110955113300012003PermafrostSANVWLPHVIVGAAAIFLGLATKQSGGYSYRKSIDTPTTAAG*
Ga0157341_105082323300012494Arabidopsis RhizospherePFVVIGVAAIFLGLTTKQVGGYRYGTSPRTTATG*
Ga0157330_102107023300012514SoilGFADESANVWLPHVVVGLAAVFLGLTTVQRGYSYLRAEHPAAG*
Ga0157291_1016929913300012902SoilETANVWLPFVVVGLAAIFLGLTTDQQGGYSYSKSRSTQTPAAG*
Ga0157283_1002396913300012907SoilFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA*
Ga0126375_1120717133300012948Tropical Forest SoilWLPFVVIGAAAVFLGLTTKQQGGYSYGASRTAAG*
Ga0164301_1152089523300012960SoilFGFADESANVWVPFVVVGLAAVFLGLTTKQAGGYSYRRAETHPAAG*
Ga0157372_1043651513300013307Corn RhizosphereSANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH*
Ga0157372_1109517413300013307Corn RhizosphereDSANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH*
Ga0134079_1076381613300014166Grasslands SoilGFADESANVWLPHLVVGLAAVFLGLTTKQAGGYRYGKASTAVG*
Ga0075314_115388423300014265Natural And Restored WetlandsANAWAPFVVVGLAAVFLGLTTKQRGGYSYRKTPAAT*
Ga0182001_1053841813300014488SoilHLVVGLAAVFLGLTTKQAGGYSYRKADRPSTAIG*
Ga0173483_1084874423300015077SoilLFGFADEGANAWAPFVVVGLAAVVLGLTTKQRGRDSYRKTPAAT*
Ga0132255_10063255543300015374Arabidopsis RhizosphereADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0132255_10442506323300015374Arabidopsis RhizosphereLFGFADQGTNFWLPFVVIGVAAVFLGLTTKQAGGYSYGKTSTPSRA*
Ga0184608_1003994813300018028Groundwater SedimentESANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0184619_1001651513300018061Groundwater SedimentTANVWVPHVVVGLAAIFLGLTTVQQGYSYRKSSAPTTATG
Ga0190270_1141823313300018469SoilFADESANVWAPHVVVGLAAIFLGLTTVQQGYSYRKGGTTQTTAAG
Ga0066669_1142082713300018482Grasslands SoilWVPHLVVGPAANFLGLTTVQQGGYSYRKRTTPTTAAG
Ga0173479_1013698023300019362SoilANVWLPFVVVGLAAIFLGLTTKQQGGYSYSKSRSTQTPAAG
Ga0207685_1070238413300025905Corn, Switchgrass And Miscanthus RhizosphereSDESANVWLPHVVVGLAAIFLGLTTVQRGYSYHRAEHQAAG
Ga0207643_1030753623300025908Miscanthus RhizosphereLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR
Ga0207707_1045834423300025912Corn RhizosphereAGESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR
Ga0207707_1157859213300025912Corn RhizosphereDESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEYPAAG
Ga0207671_1160139813300025914Corn RhizosphereANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH
Ga0207663_1103261713300025916Corn, Switchgrass And Miscanthus RhizosphereWVPHVVVGLAAVFLGLTTKQSGGYSYRRAETPRPAAG
Ga0207660_1040117313300025917Corn RhizosphereADNSANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH
Ga0207657_1059469813300025919Corn RhizosphereADNSANVWVPHLVVGLAAIFLGLTTIQQGGYSYRKSPNAVTG
Ga0207649_1166353313300025920Corn RhizosphereADNSANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH
Ga0207659_1186733313300025926Miscanthus RhizospherePHVVVGLAAIFLGLTTKQAGGYSYRKRGTGTPTAATR
Ga0207687_1055761313300025927Miscanthus RhizosphereSANVWAPFVVVGLAAIFLGLTTKQAGGYSYRRTETHPAAG
Ga0207687_1127194633300025927Miscanthus RhizosphereADESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0207664_1047636233300025929Agricultural SoilANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG
Ga0207709_1076556113300025935Miscanthus RhizosphereANVCAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG
Ga0207661_1071439213300025944Corn RhizosphereSANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH
Ga0207661_1072906013300025944Corn RhizosphereSTNVWAPHVIVGVAAIFLGLTTKQSGGYRYRRAETPAAG
Ga0207661_1122212823300025944Corn RhizosphereVPHVVVGLAAVFLGLTTVQKAGYSYRKSTTPTTAAG
Ga0207677_1048725613300026023Miscanthus RhizosphereDPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG
Ga0209474_1011915013300026550SoilGFADETANAWVPHLVVGPAANFLGLTTVQRGGYSYRKGAAAAAG
Ga0209689_115440113300027748SoilETANVWVPHLVVGIAAIFLGLTTVQQGGYSYRKSGTTQTAAG
Ga0247818_1116119023300028589SoilNVWAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG
Ga0307322_1004428933300028710SoilGFADESANVWVPHLVVGLAAIFLGLTTIQQGYGYRRSPTTAAG
Ga0307311_1000388363300028716SoilDESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0307311_1025097013300028716SoilSAHVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307301_1009107913300028719SoilNVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0307316_1020196813300028755SoilSANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307288_1018676113300028778SoilWIFGFADEGANVWAPFVVVGIAAIGLGLTTKQKGGYSYRRTSTVTG
Ga0307284_1019969113300028799SoilDESANVWAPHLIVGLAAIFLGLTTIQQGYSYRRSGATTAAG
Ga0307284_1036676913300028799SoilFADESANVWAQHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0307503_1012702013300028802SoilRGLHSAWILNVVIGLAAVFLGLTTKQSGGYSYGRSEHPATG
Ga0307294_1015450413300028810SoilESANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307294_1027646313300028810SoilSANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0307292_1006917833300028811SoilWVPHLVVGLAAVFLGLATKQQGGYSYRKSGATPTTAAG
Ga0307312_1022155613300028828SoilTANVWVPHVIVGLAAVFLGLTTKQQGGYSYRKADTPRTAVG
Ga0307286_1005154433300028876SoilADEGTNVWLPHVVVGLAAIFLGLTTKQSGGYSYGRTEHPATG
Ga0307300_1012011933300028880SoilFGFANESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0247826_1028197313300030336SoilEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG
Ga0307501_1009861523300031152SoilDYIVGAADRPQLIVGIAAVFLGLTTVQQGYSYRRSATTASG
Ga0310887_1036886323300031547SoilWLFGFADDGTNFWLPFVVIGVAAMFLGLTTKQQGGYSYGKTSTPTTA
Ga0310892_1023610413300031858SoilDEGANAWAPFVVVGVAAIFLGLTTKQRGGYSYRKSPATT
Ga0307470_1009359413300032174Hardwood Forest SoilFGFADEGTNVWLPHVIVGVAAIFLGLTTKQSGSYSYRRSEHPVTG
Ga0310896_1053561123300032211SoilADEGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.