NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087576

Metagenome / Metatranscriptome Family F087576

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087576
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 40 residues
Representative Sequence TKLAKKLDDGEYAYSWLEERVPAAGDADEDPAGVTSHF
Number of Associated Samples 100
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 97.27 %
% of genes from short scaffolds (< 2000 bps) 91.82 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.364 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.09%    β-sheet: 0.00%    Coil/Unstructured: 90.91%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF12710HAD 33.64
PF00480ROK 20.91
PF01557FAA_hydrolase 2.73
PF00353HemolysinCabind 2.73
PF00730HhH-GPD 1.82
PF01391Collagen 1.82
PF01979Amidohydro_1 1.82
PF01380SIS 1.82
PF16296TM_PBP2_N 0.91
PF13586DDE_Tnp_1_2 0.91
PF03631Virul_fac_BrkB 0.91
PF01614IclR 0.91
PF04209HgmA_C 0.91
PF14534DUF4440 0.91
PF00563EAL 0.91
PF00528BPD_transp_1 0.91
PF02518HATPase_c 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 41.82
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.82
COG0177Endonuclease IIIReplication, recombination and repair [L] 1.82
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.82
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 1.82
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 1.82
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.91
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.91
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.91
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.91
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.91
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.91
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.73 %
UnclassifiedrootN/A17.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320005|FACEOR_FY84VJD01DV5P6All Organisms → cellular organisms → Bacteria513Open in IMG/M
2189573001|GZR05M101DAMUUNot Available518Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11154990All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300000956|JGI10216J12902_108443449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300000956|JGI10216J12902_116379814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300000956|JGI10216J12902_118412111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300001664|P5cmW16_1028279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1056Open in IMG/M
3300004114|Ga0062593_101857414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300004480|Ga0062592_100428070All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300004643|Ga0062591_102260057All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005437|Ga0070710_10117866All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300005440|Ga0070705_100424665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300005456|Ga0070678_100211299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1608Open in IMG/M
3300005471|Ga0070698_100014317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8382Open in IMG/M
3300005540|Ga0066697_10630579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300005558|Ga0066698_10498964Not Available827Open in IMG/M
3300005718|Ga0068866_10591067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300005844|Ga0068862_100993326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300006175|Ga0070712_100334726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300006791|Ga0066653_10705780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300006804|Ga0079221_11212205Not Available587Open in IMG/M
3300006852|Ga0075433_10257233All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300006876|Ga0079217_11306496Not Available560Open in IMG/M
3300006904|Ga0075424_102106026Not Available594Open in IMG/M
3300009012|Ga0066710_101950507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300009012|Ga0066710_103185317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300009098|Ga0105245_10034418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4493Open in IMG/M
3300009098|Ga0105245_10739596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1019Open in IMG/M
3300009100|Ga0075418_11725873Not Available681Open in IMG/M
3300009137|Ga0066709_103966744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300009148|Ga0105243_11773746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300009156|Ga0111538_11630182Not Available813Open in IMG/M
3300009162|Ga0075423_10326169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1610Open in IMG/M
3300009176|Ga0105242_10278949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1517Open in IMG/M
3300009812|Ga0105067_1017039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium977Open in IMG/M
3300009813|Ga0105057_1023773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300010038|Ga0126315_11221879Not Available511Open in IMG/M
3300010039|Ga0126309_10508733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300010044|Ga0126310_10815030Not Available719Open in IMG/M
3300010044|Ga0126310_11838178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300010109|Ga0127497_1074577All Organisms → cellular organisms → Bacteria → Terrabacteria group668Open in IMG/M
3300010145|Ga0126321_1181029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300010166|Ga0126306_10020492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4359Open in IMG/M
3300010360|Ga0126372_13252894Not Available505Open in IMG/M
3300010371|Ga0134125_10961356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium937Open in IMG/M
3300010396|Ga0134126_11740121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300010396|Ga0134126_12754415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300011412|Ga0137424_1000857All Organisms → cellular organisms → Bacteria2577Open in IMG/M
3300012011|Ga0120152_1145022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300012096|Ga0137389_10840968Not Available788Open in IMG/M
3300012354|Ga0137366_10470663Not Available909Open in IMG/M
3300012356|Ga0137371_10132379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1952Open in IMG/M
3300012892|Ga0157294_10265672All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300012902|Ga0157291_10347241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012905|Ga0157296_10198459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300012960|Ga0164301_11597791Not Available541Open in IMG/M
3300012961|Ga0164302_11424210All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012989|Ga0164305_10308386All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300013306|Ga0163162_12931968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300014497|Ga0182008_10748125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300015201|Ga0173478_10859101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300015374|Ga0132255_105663554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300017965|Ga0190266_10552488Not Available685Open in IMG/M
3300018027|Ga0184605_10263600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium782Open in IMG/M
3300018073|Ga0184624_10229993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300018074|Ga0184640_10306792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300018089|Ga0187774_10727480Not Available660Open in IMG/M
3300018431|Ga0066655_10712820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300018433|Ga0066667_10214613All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300018476|Ga0190274_13711412All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300019259|Ga0184646_1140243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300019361|Ga0173482_10403128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300020059|Ga0193745_1015657All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300022195|Ga0222625_1349550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300024254|Ga0247661_1097614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300024317|Ga0247660_1024688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium954Open in IMG/M
3300025927|Ga0207687_11076388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300025928|Ga0207700_10284979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300025932|Ga0207690_10698031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300025935|Ga0207709_10369826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1088Open in IMG/M
3300026295|Ga0209234_1042823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1721Open in IMG/M
3300027169|Ga0209897_1048243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300027310|Ga0207983_1011627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1012Open in IMG/M
3300027695|Ga0209966_1116021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300027821|Ga0209811_10318927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300028380|Ga0268265_11326603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300028707|Ga0307291_1002893All Organisms → cellular organisms → Bacteria3716Open in IMG/M
3300028715|Ga0307313_10189548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300028717|Ga0307298_10011509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2212Open in IMG/M
3300028717|Ga0307298_10245583Not Available531Open in IMG/M
3300028720|Ga0307317_10225335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300028721|Ga0307315_10095610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium870Open in IMG/M
3300028721|Ga0307315_10246725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300028787|Ga0307323_10132025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium899Open in IMG/M
3300028799|Ga0307284_10002773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4655Open in IMG/M
3300028810|Ga0307294_10428875All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300028811|Ga0307292_10185281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300028814|Ga0307302_10050698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1931Open in IMG/M
3300028828|Ga0307312_10078253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2018Open in IMG/M
3300028828|Ga0307312_11091929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300028878|Ga0307278_10249325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300028881|Ga0307277_10441773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300028881|Ga0307277_10545632Not Available520Open in IMG/M
3300030006|Ga0299907_10062652All Organisms → cellular organisms → Bacteria2988Open in IMG/M
3300030336|Ga0247826_11229945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300031890|Ga0306925_11703290Not Available608Open in IMG/M
3300031903|Ga0307407_10657006Not Available786Open in IMG/M
3300031910|Ga0306923_12225929All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300032954|Ga0335083_10618398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300033551|Ga0247830_11707203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.45%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.73%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.73%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.91%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320005Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-EnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009813Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010109Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027169Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORA_7880602032320005SoilCATTFHPLRLTKLAQGLDDGEYAYSWLEEREPGVGDSDGDPAGVTSHF
FD2_025422802189573001Grass SoilLAQGLDDGEYAYSWLEERAPEVGDSDGDPAGVTSHF
ICChiseqgaiiFebDRAFT_1115499013300000363SoilFHPLRLTKLAKKLDDGKYAYSWLEERAPAAGNADEDPAGVTSHF*
JGI10216J12902_10844344913300000956SoilRELDDGEYAYSWLEERVPAGESADEDPAGVTSHF*
JGI10216J12902_11637981423300000956SoilFHPLKLSALAKETEDPTYAYSWYEEPDAAKEAKNADEDPAGVTSHF*
JGI10216J12902_11841211123300000956SoilFHPLRLTAFARELDDPAYAYSWYEPSDAAKEAASADEDPAGVTSHF*
P5cmW16_102827933300001664PermafrostTKLAKGLDDGEYAYSWYEEPDAVKEAKSADEDPAGVTSHF*
Ga0062593_10185741413300004114SoilRLTTLGQTMDDGQYAYSWNEDLVPQADATPDDDPAGVTSHF*
Ga0062592_10042807013300004480SoilRLSPLARDTEDPKYAYSWYEEPEAAKDARTADEDPAGVTSHF*
Ga0062591_10226005713300004643SoilFHPLRLTKLAKGLDDGEYAYSWLEERAPAAGDSDADPAGVTSHF*
Ga0070710_1011786633300005437Corn, Switchgrass And Miscanthus RhizospherePLRLTPFAHGLDDGTYAYSWYEEPAAPGDTADDDPAGVTSHF*
Ga0070705_10042466523300005440Corn, Switchgrass And Miscanthus RhizosphereHPLRLTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF*
Ga0070678_10021129933300005456Miscanthus RhizosphereLTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF*
Ga0070698_10001431713300005471Corn, Switchgrass And Miscanthus RhizosphereLTKLAKGLDDGEYAYSWLDERVPAAGSPDEDPAGVTSHF*
Ga0066697_1063057923300005540SoilKKLDDGQYAYSWLDEGAPPVESADEDPAGVTSHF*
Ga0066698_1049896413300005558SoilLTKLAKELDDGTYWHSWFEDPAPVSTADEDPAGVTSHF*
Ga0068866_1059106723300005718Miscanthus RhizosphereTEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF*
Ga0068862_10099332613300005844Switchgrass RhizosphereTKLAKGLDDGKYAYSWLEEHAPADADEDPAGVTSHF*
Ga0070712_10033472633300006175Corn, Switchgrass And Miscanthus RhizosphereRLTKLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF*
Ga0066653_1070578013300006791SoilPLKLSALARETEDPTYAYSWYEEPEAAKEARTADEDPAGVTSHF*
Ga0079221_1121220523300006804Agricultural SoilMSVDWMRLTPFAHGLDDGTYAYSWYEEPAAPGDTADDDPAGVTSHF*
Ga0075433_1025723333300006852Populus RhizosphereKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF*
Ga0079217_1130649623300006876Agricultural SoilLAREQDDPRYAYSWYDEPTAVRTADEDPAGVTSHL*
Ga0075424_10210602623300006904Populus RhizosphereLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF*
Ga0066710_10195050713300009012Grasslands SoilPLRLTKLAKGLDDGEYAYSWLDERAPAAGSADEDPAGVTSHF
Ga0066710_10318531723300009012Grasslands SoilAKKLDDGQYAYSWLDERAPAAESADEDPAGVTSHF
Ga0105245_1003441813300009098Miscanthus RhizospherePLRLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF*
Ga0105245_1073959613300009098Miscanthus RhizosphereLAKKLDDGEYAYSWLDERAPAEGSTDEDPAGVTSHF*
Ga0075418_1172587313300009100Populus RhizosphereHPLRLGKLAAGLDDGRYAFSWLEDPEPVKTADEDPAGVTSHF*
Ga0066709_10396674423300009137Grasslands SoilTKLAKKLDDGEYAYSWLEERVPAAGDADEDPAGVTSHF*
Ga0105243_1177374613300009148Miscanthus RhizosphereLTKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF*
Ga0111538_1163018233300009156Populus RhizosphereTLARDLDKPEYAYSWYEAPDQPATADENPAGVTSHF*
Ga0075423_1032616933300009162Populus RhizosphereRLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF*
Ga0105242_1027894913300009176Miscanthus RhizosphereRLTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF*
Ga0105067_101703933300009812Groundwater SandLTELALELDDPGYAYSWYEAAEATKEAASSDEDPAGVTSHL*
Ga0105057_102377313300009813Groundwater SandPLRLAAFARELDEPGYAYSWFEAPEAAKAAKTADEDPAGVTSHF*
Ga0126315_1122187913300010038Serpentine SoilRLTTLARELDDGHYAYSWYEEPAPAGSADENPAGVTSHF*
Ga0126309_1050873323300010039Serpentine SoilLTKLAKKLDDGEYAYSWLEERAPATGDADEDPAGVTSHF*
Ga0126310_1081503023300010044Serpentine SoilKLAKELDDGTYWRSWFEDPAPAANADEDPAGVTSHF*
Ga0126310_1183817823300010044Serpentine SoilTALAADLDDGRYAYSWAEDPGPADARNADEDPAGVTSHF*
Ga0127497_107457723300010109Grasslands SoilVRHVPPLRLTALAKELDDGEYAYSWLEERVPAGESPDEDPAGVTSHF*
Ga0126321_118102913300010145SoilLDDPAYAYSWYEESDAAKQAKDADEDPAGVTSHF*
Ga0126306_1002049213300010166Serpentine SoilKLAKGLDDGKYAYSWYEAADQSADADENPAGVTSHF*
Ga0126372_1325289413300010360Tropical Forest SoilELARGLDDGRYMYSWYEAPEYAREAADTDEDPAGVTSHF*
Ga0134125_1096135613300010371Terrestrial SoilLAKKLDDGEYAYSWLEERAPEAGDTNADPAGVTSHF*
Ga0134126_1174012123300010396Terrestrial SoilHPLKLSALAKDTEDPSYAYSWYEEPDAVKEAKNADEDPAGVTSHF*
Ga0134126_1275441513300010396Terrestrial SoilPLRLTKLAKDLDDGEYAYSWLDERAPAAGDTDEDPAGVTSHF*
Ga0137424_100085753300011412SoilSALARELDDPGYGYSWFEAGEGAESADEDPAGVTSHL*
Ga0120152_114502223300012011PermafrostRLTKFSKELDDPSYAYSWYEEPDAVKEAKTADEDPAGVTSHF*
Ga0137389_1084096833300012096Vadose Zone SoilLRLTTFARELDDGKYAYSWDEEPGAAASTDDDPAGVTSHF*
Ga0137366_1047066313300012354Vadose Zone SoilKKLDDGEYAYSWLEERAPVAGSADEDPAGVTSHF*
Ga0137371_1013237943300012356Vadose Zone SoilTKLARELDDGKYWHSWFEDPAPVGTADEDPAGVTSHF*
Ga0157294_1026567213300012892SoilTEDPAYAYSWYEEPDAVKEAKNADEDPAGVTSHF*
Ga0157291_1034724123300012902SoilLDDGKYAYSWYEEPESVKEATNADEDPAGVTSHF*
Ga0157296_1019845913300012905SoilHPLKLSALAKDTEDPEYAYSWYEEPDAVKDAKNADEDPAGVTSHF*
Ga0164301_1159779123300012960SoilKKLDDGKYAYSWLEERAPAGGSPDEDPAGVTSHF*
Ga0164302_1142421023300012961SoilCDTFHPLRLTKLAKDLDDGTYWHSWFEDPAPVGNADEDPAGVTSHF*
Ga0164305_1030838633300012989SoilAKDLDDGTYWHSWFEDPAPVGNADEDPAGVTSHF*
Ga0163162_1293196823300013306Switchgrass RhizosphereKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHV*
Ga0182008_1074812513300014497RhizosphereFHPLRLTKLAKSMDDGEYAYSWLDDRVPAAGNADEDPAGVTSHF*
Ga0173478_1085910123300015201SoilALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF*
Ga0132255_10566355423300015374Arabidopsis RhizosphereKDTEDPKYAYSWYEEPDAAKEARNADEDPAGVTSHF*
Ga0190266_1055248823300017965SoilKLAKSLDDGKYAYSWYDTPDQPADADENPAGVTSHF
Ga0184605_1026360023300018027Groundwater SedimentRLTKLAKELDDGEYAYSWLDERAPAAGSADEDPAGVTSHF
Ga0184624_1022999313300018073Groundwater SedimentRLTELAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF
Ga0184640_1030679213300018074Groundwater SedimentLAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF
Ga0187774_1072748013300018089Tropical PeatlandPLRLTTFARDLDDGKYWRSWYDDPTPTGDADADPAGVTSHL
Ga0066655_1071282023300018431Grasslands SoilDTFHPLRLTKLAKKLDDGQYAYSWLDERAPAAESADEDPAGVTSHF
Ga0066667_1021461313300018433Grasslands SoilPLRLTTLALELDDPSYAYSWHEESGAAASADEDPAGVTSHL
Ga0190274_1371141223300018476SoilFHPLKLTKLAKSLDDGKYAYSWYDTPDQPADADENPAGVTSHF
Ga0184646_114024313300019259Groundwater SedimentARELDDPSYAYSWYEEPAAAKVASSADEDPAGVTSHL
Ga0173482_1040312823300019361SoilSPLARDTEDPKYAYSWYEEPEAAKDARTADEDPAGVTSHF
Ga0193745_101565713300020059SoilRLTKLAKKLDDGKYWRSWSEDHAPAAANADEDPAGVTSHF
Ga0222625_134955013300022195Groundwater SedimentLTELARELDDPSYAYSWYEEPAAAKVASSADEDPAGVTSHL
Ga0247661_109761423300024254SoilKLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF
Ga0247660_102468823300024317SoilDTFHPLRLTKLAMGLDDGEYAYSWLEEHAAGAGDSDADPAGVTSHF
Ga0207687_1107638833300025927Miscanthus RhizosphereKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF
Ga0207700_1028497933300025928Corn, Switchgrass And Miscanthus RhizosphereHPLRLTKLAQGLDDGEYAYSWLEERAPAGDADEDPAGVTSHF
Ga0207690_1069803113300025932Corn RhizosphereTKLAKKLDDGEYAYSWLEERAPAAGDTDADPAGVTSHF
Ga0207709_1036982613300025935Miscanthus RhizosphereLSALAKDTEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF
Ga0209234_104282313300026295Grasslands SoilLAKDLDDGTYWRSWFEDPAPVGNADEDPAGVTSHF
Ga0209897_104824313300027169Groundwater SandAFARELDEPGYAYSWFEAPEAAKAAKTADEDPAGVTSHF
Ga0207983_101162713300027310SoilMHARPAVKLTKLAKGLDDGKYAYSWYDSPDQPADADENPAGVTSHF
Ga0209966_111602113300027695Arabidopsis Thaliana RhizospherePLRLTKLAQGLDDGEYAYSWLEERVPAGGSPDDDPAGVTSHF
Ga0209811_1031892723300027821Surface SoilALAKDTEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF
Ga0268265_1132660313300028380Switchgrass RhizosphereFHPLRLTKLAKGLDDGKYAYSWLEEHAPADADEDPAGVTSHF
Ga0307291_100289353300028707SoilLTKLAKKLDDGEYAYSWLDERAPAEGNTDEDPAGVTSHF
Ga0307313_1018954823300028715SoilTKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF
Ga0307298_1001150913300028717SoilAKETEDPAYAYSWYEEPDAVKEAKNADEDPAGVTSHF
Ga0307298_1024558313300028717SoilLRLTELARELDEPSYAYSWYEEPAAAKGASSADQDPAGVTSHL
Ga0307317_1022533523300028720SoilLRLTELAKGLDDPAYAYSWFEADAAPDAASGDEDPAGVTSHF
Ga0307315_1009561033300028721SoilLAKELDDGKYAYSWYEEPEAVKEATNADEDPAGVTSHF
Ga0307315_1024672513300028721SoilTFHPLRLTKLAKKLDDGQYAYSWLEERTPAAGSADEDPAGVTSHF
Ga0307323_1013202523300028787SoilHPMRLTKLAKGLDDGKYAYSWLEEHVPADADEDPAGVTSHF
Ga0307284_1000277313300028799SoilLTKLAKGLDDGEYAYSWLDERTPAEGSTDEDPAGVTSHF
Ga0307294_1042887513300028810SoilPLRLTKLAKKLDDGQYAYSWLEERVPAAGDADEDPAGVTSHF
Ga0307292_1018528123300028811SoilPLRLTKLAKKLDDGKYWRSWSEDHSPAAENADEDPAGVTSHF
Ga0307302_1005069843300028814SoilALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF
Ga0307312_1007825343300028828SoilLRLTKLAKGLDDGEYAYSWLDERAPAQGSTDEDPAGVTSHF
Ga0307312_1109192913300028828SoilRLTKLAKKLDDGEYAYSWLEERVPAGESADEDPAGVTSHF
Ga0307278_1024932523300028878SoilSDTFHPLRLTKLAKSLDDGEYAYSWLEERVPAAGNADEDPAGVTSHF
Ga0307277_1044177313300028881SoilLRLTKLAKELDDGKYAYSWSEPAEPAQDADADPAGVTSHF
Ga0307277_1054563213300028881SoilKLAKSLDDGEYAYSWLEERVPAAGNADEDPAGVTSHF
Ga0299907_1006265253300030006SoilFARGLDDPGYAYSWFEAPDAAKSAKTADEDPAGVTSHF
Ga0247826_1122994523300030336SoilFHPLKLTALAKETEDPSYAYSWYEEPDAAKEAKNADEDPAGVTSHF
Ga0306925_1170329013300031890SoilLRLTTLARDLDDGVYWRSWFEEPADAAGADEDPAGVTSHF
Ga0307407_1065700613300031903RhizosphereTKLAEELDDGEYAYSWNEDLVKTPAASTDEDPAGVTSHL
Ga0306923_1222592913300031910SoilDTFHPLRLTKLAQGLEDGTYWHSWFEDPAPVGSADEDPAGVTSHF
Ga0335083_1061839813300032954SoilLTKLAQALDDGEYAYSWLEERVPEAVDTDQDPAGVTSHF
Ga0247830_1170720313300033551SoilFHPLRVSALARGLDDPSYAYSWFEAPEAGTADQDPAGVTSHL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.