NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087540

Metagenome Family F087540

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087540
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 38 residues
Representative Sequence MEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRAS
Number of Associated Samples 89
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.29 %
% of genes near scaffold ends (potentially truncated) 74.55 %
% of genes from short scaffolds (< 2000 bps) 91.82 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.909 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.636 % of family members)
Environment Ontology (ENVO) Unclassified
(40.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.273 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF08240ADH_N 12.73
PF13561adh_short_C2 10.91
PF00596Aldolase_II 9.09
PF00106adh_short 4.55
PF00107ADH_zinc_N 1.82
PF10861DUF2784 0.91
PF00496SBP_bac_5 0.91
PF00034Cytochrom_C 0.91
PF13610DDE_Tnp_IS240 0.91
PF05019Coq4 0.91
PF07386DUF1499 0.91
PF00043GST_C 0.91
PF03237Terminase_6N 0.91
PF02586SRAP 0.91
PF12706Lactamase_B_2 0.91
PF07969Amidohydro_3 0.91
PF00313CSD 0.91
PF14534DUF4440 0.91
PF07690MFS_1 0.91
PF03928HbpS-like 0.91
PF12833HTH_18 0.91
PF15902Sortilin-Vps10 0.91
PF00561Abhydrolase_1 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.91
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.91
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.91
COG4446Uncharacterized conserved protein, DUF1499 familyFunction unknown [S] 0.91
COG5031Ubiquinone biosynthesis protein Coq4Coenzyme transport and metabolism [H] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.91 %
UnclassifiedrootN/A39.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005176|Ga0066679_10372984All Organisms → cellular organisms → Bacteria → Proteobacteria934Open in IMG/M
3300005332|Ga0066388_105024958All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum672Open in IMG/M
3300005332|Ga0066388_108151346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300005437|Ga0070710_11436164All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300005610|Ga0070763_10925284All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300005713|Ga0066905_101438841Not Available625Open in IMG/M
3300005764|Ga0066903_103417752All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005764|Ga0066903_104192039All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300006050|Ga0075028_100808765All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006175|Ga0070712_101294808All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006954|Ga0079219_10101098All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300007255|Ga0099791_10541612Not Available567Open in IMG/M
3300007788|Ga0099795_10531453All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11552Open in IMG/M
3300009089|Ga0099828_11525231All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009792|Ga0126374_10694190Not Available764Open in IMG/M
3300010046|Ga0126384_11179092All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium706Open in IMG/M
3300010048|Ga0126373_10033500Not Available4462Open in IMG/M
3300010326|Ga0134065_10310465Not Available607Open in IMG/M
3300010341|Ga0074045_10105821All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300010358|Ga0126370_11220629All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300010361|Ga0126378_10161222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2293Open in IMG/M
3300010366|Ga0126379_12094325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium668Open in IMG/M
3300010376|Ga0126381_102797948All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300011269|Ga0137392_11622580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300011271|Ga0137393_10749100All Organisms → cellular organisms → Bacteria → Proteobacteria836Open in IMG/M
3300011410|Ga0137440_1097144All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012096|Ga0137389_11225661Not Available643Open in IMG/M
3300012203|Ga0137399_11089390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300012203|Ga0137399_11101666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium669Open in IMG/M
3300012205|Ga0137362_10377490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1228Open in IMG/M
3300012208|Ga0137376_10746583All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012361|Ga0137360_11605869Not Available555Open in IMG/M
3300012923|Ga0137359_11171817Not Available656Open in IMG/M
3300012927|Ga0137416_11574830Not Available598Open in IMG/M
3300012929|Ga0137404_11565142Not Available611Open in IMG/M
3300012971|Ga0126369_11776339Not Available705Open in IMG/M
3300016270|Ga0182036_10290342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1240Open in IMG/M
3300016270|Ga0182036_10341494Not Available1151Open in IMG/M
3300016270|Ga0182036_10452335Not Available1010Open in IMG/M
3300016270|Ga0182036_11064265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis669Open in IMG/M
3300016294|Ga0182041_11423119Not Available637Open in IMG/M
3300016357|Ga0182032_10583077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300016357|Ga0182032_10916621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium745Open in IMG/M
3300016387|Ga0182040_11964823Not Available502Open in IMG/M
3300016404|Ga0182037_10107833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2019Open in IMG/M
3300016404|Ga0182037_10134019All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300018468|Ga0066662_12803719Not Available517Open in IMG/M
3300021168|Ga0210406_10854181All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300021168|Ga0210406_11271202Not Available532Open in IMG/M
3300021362|Ga0213882_10258924All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300021401|Ga0210393_10613806All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300021432|Ga0210384_11614366All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300021474|Ga0210390_11309298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300021479|Ga0210410_11553014Not Available555Open in IMG/M
3300021560|Ga0126371_10355510All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300021560|Ga0126371_11033817All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300021560|Ga0126371_13020508Not Available570Open in IMG/M
3300025898|Ga0207692_10461313All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300026330|Ga0209473_1325638All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300027049|Ga0207806_1042842Not Available516Open in IMG/M
3300027603|Ga0209331_1043831Not Available1137Open in IMG/M
3300027812|Ga0209656_10156542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1137Open in IMG/M
3300027855|Ga0209693_10392221Not Available671Open in IMG/M
3300031231|Ga0170824_124974020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1801Open in IMG/M
3300031469|Ga0170819_11579150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium larrymoorei714Open in IMG/M
3300031564|Ga0318573_10408523All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300031572|Ga0318515_10174786All Organisms → cellular organisms → Bacteria → Proteobacteria1148Open in IMG/M
3300031679|Ga0318561_10091004All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300031682|Ga0318560_10562335Not Available618Open in IMG/M
3300031708|Ga0310686_107095990Not Available951Open in IMG/M
3300031719|Ga0306917_10449596All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300031719|Ga0306917_11464053All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300031724|Ga0318500_10160601Not Available1061Open in IMG/M
3300031744|Ga0306918_10329912All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300031744|Ga0306918_10545519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium908Open in IMG/M
3300031744|Ga0306918_10550381Not Available904Open in IMG/M
3300031754|Ga0307475_11135461Not Available610Open in IMG/M
3300031763|Ga0318537_10079356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1208Open in IMG/M
3300031795|Ga0318557_10424791All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300031823|Ga0307478_10405269Not Available1130Open in IMG/M
3300031823|Ga0307478_11594938All Organisms → cellular organisms → Bacteria → Proteobacteria539Open in IMG/M
3300031835|Ga0318517_10562891Not Available512Open in IMG/M
3300031846|Ga0318512_10435835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300031860|Ga0318495_10438030Not Available574Open in IMG/M
3300031879|Ga0306919_10601251Not Available848Open in IMG/M
3300031890|Ga0306925_10456897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1364Open in IMG/M
3300031890|Ga0306925_10602071All Organisms → cellular organisms → Bacteria → Proteobacteria1160Open in IMG/M
3300031910|Ga0306923_10585929All Organisms → cellular organisms → Bacteria → Acidobacteria1253Open in IMG/M
3300031910|Ga0306923_10702076Not Available1126Open in IMG/M
3300031910|Ga0306923_11897073Not Available608Open in IMG/M
3300031912|Ga0306921_10475021All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300031941|Ga0310912_11188009Not Available581Open in IMG/M
3300031942|Ga0310916_10427626Not Available1127Open in IMG/M
3300031947|Ga0310909_10099772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2332Open in IMG/M
3300031947|Ga0310909_10213514All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300031962|Ga0307479_11309133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium685Open in IMG/M
3300031965|Ga0326597_11547783Not Available634Open in IMG/M
3300031981|Ga0318531_10272746All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300032001|Ga0306922_11757418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300032001|Ga0306922_11837112Not Available595Open in IMG/M
3300032039|Ga0318559_10340496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium698Open in IMG/M
3300032055|Ga0318575_10329335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis773Open in IMG/M
3300032160|Ga0311301_12346755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300032180|Ga0307471_101892187Not Available746Open in IMG/M
3300033289|Ga0310914_10271970All Organisms → cellular organisms → Bacteria → Acidobacteria1525Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.91%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.91%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300027049Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066679_1037298423300005176SoilMKAYHIDRFGSVGGIARRSSQDPRPGLKEVLMRVRASSLNY
Ga0066388_10502495813300005332Tropical Forest SoilMKAYRIDRFGGVDGIVLQSSDDPRPGLGEVLIRVRTSTAPELL*
Ga0066388_10815134623300005332Tropical Forest SoilMEEEEMEAYRIKRFGGVDGISPEVSGDPHPGPREVLMRVRAS
Ga0070710_1143616423300005437Corn, Switchgrass And Miscanthus RhizosphereMEAYHIDRFGMVRRSSEDPRPGLKEVVMRVRASSLNYRDLMVL
Ga0070763_1092528423300005610SoilMEAYRIDRFGSVDGIVSRSSVDPRPGLKEVLMRVRASSLN
Ga0066905_10143884113300005713Tropical Forest SoilMKAYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL*
Ga0066903_10341775213300005764Tropical Forest SoilMKAYRIDRFGGVDGIVLQSIDDPRPGLGEVLIRVRTSTAPELL*
Ga0066903_10419203933300005764Tropical Forest SoilMKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRASSL
Ga0075028_10080876523300006050WatershedsMKAYHIDRFGSVGGIVRRSSEDPRPGPKEILMRVCAS
Ga0070712_10129480813300006175Corn, Switchgrass And Miscanthus RhizosphereMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRASS
Ga0079219_1010109823300006954Agricultural SoilMKAYHIDRFGGVGGIVRRSSEDPRPGPKEVLMRVRASSL
Ga0099791_1054161223300007255Vadose Zone SoilMEAYRVDRFGSVDGIVLRSSEDPRLGPQEILMRVRASSL
Ga0099795_1053145323300007788Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVR
Ga0099828_1152523123300009089Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRELA*
Ga0126374_1069419023300009792Tropical Forest SoilMKAYRIDRFVGVDGIVLQSSDDPRPGLGEVLIRMRASTAPELL*
Ga0126384_1117909233300010046Tropical Forest SoilMKAHRIDRFGGVDGIVLQSIDDPRPGLGEVLIPVRTSTAPELL*
Ga0126373_1003350013300010048Tropical Forest SoilMEAYRIDRFGSVDGIVLRSSEDPQPGPKEVLMRVR
Ga0134065_1031046523300010326Grasslands SoilMKAYHIDRFGSVGGIVRRSSEDPPPGRKEVLMRVRA
Ga0074045_1010582123300010341Bog Forest SoilMKAYRIGRFGGVDGIVLRSSEDPRPRPKEILMRVR*
Ga0126370_1122062913300010358Tropical Forest SoilMKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRASSLN
Ga0126378_1016122243300010361Tropical Forest SoilVEAYRIDRFGSVDGIVLRSSEDPRPGLRQILMRVRELA*
Ga0126379_1209432513300010366Tropical Forest SoilMEAYRIDRFGSVDGLVLRSSADPRPGRKEVLMRVCASFAELT
Ga0126381_10279794823300010376Tropical Forest SoilMEAYHIDHFGSVDGIVLRSSDNPRPERKEILMRVR*
Ga0150983_1036472813300011120Forest SoilEMEAYRIDRFGSVDGIVLRSSEDPRPGSKEILMRVPTRSTTAI*
Ga0137392_1162258023300011269Vadose Zone SoilMMEAYRIDRFGSVDGIALRSSEDPRPGPKEILMRVRA
Ga0137393_1074910013300011271Vadose Zone SoilVDNREEEEMESYRIDRFRSVDGIVLRSSDDPRPAPKEILM
Ga0137440_109714413300011410SoilMRAYRIESFGSVDGVVLGAGDDPQPGTREILVRMRATS
Ga0137389_1122566113300012096Vadose Zone SoilMKAYRIDRFGSVEGIVLRSSEDPRPGPKEILMRVRA
Ga0137399_1108939013300012203Vadose Zone SoilMEAYRIDRFGSVDGIVLQSSEDPRPGPKEILMRVRA
Ga0137399_1110166623300012203Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSEDPRLGPQEILMRVRASSL
Ga0137362_1037749013300012205Vadose Zone SoilMEAYRIDRFGSVDGIVFRSSEDPGPGPKEVLMRVCAS
Ga0137376_1074658323300012208Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILTRVRA
Ga0137360_1160586913300012361Vadose Zone SoilMEAYRIDSVDGVVLRSSEDPGPGPKEILMRVRASS
Ga0137359_1117181723300012923Vadose Zone SoilVDNREEEEMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRV
Ga0137416_1157483013300012927Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSDDPRSGPKEALMRVRASSL
Ga0137404_1156514213300012929Vadose Zone SoilMEAYRIDRFGSVDGIVLRSSGDPRPGPKEILMRVRASS
Ga0126369_1177633913300012971Tropical Forest SoilMEAYHIARFGSVDGIVLRSSEDPPPGRKEVLMQVRAGR*
Ga0182036_1029034223300016270SoilMEAYRIDRFGSVDGIVLRSSEDPRPGLREILMRVRASSL
Ga0182036_1034149423300016270SoilMKSYRIERFGSVDGVVLRSCDDPRPGPREILMRVRARLTTAI
Ga0182036_1045233513300016270SoilMKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRASSLN
Ga0182036_1106426523300016270SoilVEAYRIDSFGSVDGIVLRSSEDPRPGLREILMRVRA
Ga0182041_1142311923300016294SoilMKACHIDRFGSVGGIALRSSEDPQPGLREVLMRVRASSLN
Ga0182032_1058307713300016357SoilMEAYRIEHFGSVDGIMLRSSEDPRPGPKEILMRVRAS
Ga0182032_1091662123300016357SoilMEAYHIERFGSVDGIVLRSSEDPRLGLKEILMRVLAS
Ga0182040_1196482313300016387SoilVEAYRIDRFGSVDGILLRSSEDPRPGLREVLMRVRA
Ga0182037_1010783323300016404SoilMQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR
Ga0182037_1013401923300016404SoilMKAYRIDRFGGVDGIVLQSVDDPRPGLGEVLIRVRTSTAPELL
Ga0182038_1167826123300016445SoilRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI
Ga0066662_1280371913300018468Grasslands SoilMQAYRIARFGSVDGIVLRSSEDPRTEPKEILMQVRASSLN
Ga0210406_1085418113300021168SoilMKAYHIDRFGSVGGIVRRSSQDPRPGPKEVLMRVLAS
Ga0210406_1127120213300021168SoilMKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRASSL
Ga0210400_1151792323300021170SoilMEADRIDRFGSVDGIVLRVSADPRPGPKEVLMTVPRQLARLSGSDGPEG
Ga0213882_1025892423300021362Exposed RockMKAYHIDRFGNVDGFVSRSSDNPRPERKEVLMRVR
Ga0210393_1061380623300021401SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRELA
Ga0210384_1161436613300021432SoilMSKGDGMKAYCIDHFGSVDGVVLQSRAEPQPGRREILVRVGATSLNY
Ga0210390_1130929813300021474SoilMKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRASS
Ga0210410_1155301413300021479SoilMKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRAS
Ga0126371_1035551033300021560Tropical Forest SoilMKAYRIDRFGGVDGIVLQSSDDPRPGLGEVLIRMRASTAPELL
Ga0126371_1103381713300021560Tropical Forest SoilMEAYHIARFGSVDGIVLRSSEDPPPGRKEVLMQVRADR
Ga0126371_1302050833300021560Tropical Forest SoilMKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRAS
Ga0207692_1046131323300025898Corn, Switchgrass And Miscanthus RhizosphereMKAYHIDRFGSVGGIVRRSSEDPQPGLKEVLMRVR
Ga0209473_132563813300026330SoilLKAYHIDRFGSIGGIVRRSSEDPRPGLKEVLMRVCASSLN
Ga0207806_104284213300027049Tropical Forest SoilLPRQWWRVMEAYCIDRFGSVDGIVLRSSEDPRPGLKEILMR
Ga0209331_104383123300027603Forest SoilMEAYRIDRFGSVDGIVLRSSEDPRPEPKEILMRVRA
Ga0209656_1015654213300027812Bog Forest SoilMKAYRIGRFGGVDGIVLRSSEDPRPRPKEILMRVR
Ga0209693_1039222113300027855SoilMEAYHIERFGSVDGIVLRSSKDPRPGPKEVLMRVRAS
Ga0170824_12497402033300031231Forest SoilMDAYRIDRFGSVDRIVLRSSDDPRPRLREVLMRVRVSLLDYR
Ga0170819_1157915013300031469Forest SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRASALAT
Ga0318541_1012672023300031545SoilMKSYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI
Ga0318573_1040852323300031564SoilMKAYRIDRFGGVDGIVLQSIDDPRPGLGEVLIRVRTSTAPELL
Ga0318515_1017478623300031572SoilMKAYRIDRFGGVDGIVLQSVDDPRPGLEEVLIRVRTSTAPELL
Ga0318561_1009100433300031679SoilMKAYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL
Ga0318560_1056233513300031682SoilMEAYRIDRFGSVDGIVLRSSPDPRPGPKEVLMRVRSS
Ga0310686_10709599023300031708SoilMEGYHIDRFGSVDGIVLRSSEDPRPGLREVLTQVRASLLNDRDLRTGL
Ga0306917_1044959613300031719SoilRIERFGSVDGIELRSSDDPRPGLREVLMRVRASSLN
Ga0306917_1146405313300031719SoilMEAYHIDRFGSVDGIVLRSTEDPRPGLREVLMRVRASSL
Ga0318500_1016060113300031724SoilVEAYRIDSFGSVDGILLRSSEDPRPGLREVLIRVRATPL
Ga0306918_1032991213300031744SoilMKAYHVDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSL
Ga0306918_1054551913300031744SoilMKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRA
Ga0306918_1055038113300031744SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSL
Ga0307475_1113546123300031754Hardwood Forest SoilVEAYRIDSFGSVDGILLRSSEDPRPGLREVLMRVR
Ga0318537_1007935613300031763SoilMEAYRIDHFAGVDGIVLRSSPDPRPGPKEVLMRVRA
Ga0318557_1042479123300031795SoilMQAYRIERFGSVDGIELRSSDDPRPGLREVLMRVRASTLNYRD
Ga0307478_1040526923300031823Hardwood Forest SoilMEAYHIERFGSVGGIVRRSSEDPRPGLKEVLMRVHA
Ga0307478_1159493823300031823Hardwood Forest SoilMKAYHIDRFGSVGGIVRRSSEDPRPGLKEVLTRVHAS
Ga0318517_1056289113300031835SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRAS
Ga0318512_1043583513300031846SoilMKAYRVERFGSVNGIVLRSCDDPRPGPREILMRVRARLT
Ga0318495_1043803013300031860SoilMKAYRIDRFGSIGGIVRRSAEDPRPGPKEALMRVR
Ga0306919_1060125123300031879SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSLN
Ga0306925_1045689733300031890SoilMKSYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLT
Ga0306925_1060207133300031890SoilMKAYHIDRFGSIGGIARRSVEDPRPGPKEVLMRVRA
Ga0306923_1058592913300031910SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRA
Ga0306923_1070207613300031910SoilMKAYHIDRFGSIGGIARRSVEDPRPGPKEVLMRVRAS
Ga0306923_1117058233300031910SoilMKAYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI
Ga0306923_1189707313300031910SoilGGRGGEMQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR
Ga0306921_1047502113300031912SoilMEAYHIERFGSVDGIVLRSSEDPRPGLKEILMRVRASSL
Ga0310912_1118800923300031941SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRA
Ga0310916_1042762613300031942SoilLGGASEEGEMKAYHIDRFGSVGGIVRRSAEDPRPGPKEVLMRVRAS
Ga0310909_1009977243300031947SoilMRAFRIERFGSVDGIELRSSDDPRPGLREVLMRVRA
Ga0310909_1021351413300031947SoilMKAYRIDRFGGVDGIVLQSVDDPRPGLEEVLIRVRTS
Ga0307479_1130913313300031962Hardwood Forest SoilVEAYRIDRFGSVDGVVLRSSEDPRPGLREVLMRVRATSLN
Ga0326597_1154778323300031965SoilMKSYRIESFGSVDGVVLGSRDDPRPGAREILVRVR
Ga0318531_1027274613300031981SoilAYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL
Ga0306922_1175741823300032001SoilMKAYRIERFGSVDGVVLRSCDDPRPGPKEILMRVRASS
Ga0306922_1183711213300032001SoilGGEMQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR
Ga0318559_1034049613300032039SoilMKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRASS
Ga0318575_1032933513300032055SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVR
Ga0311301_1234675513300032160Peatlands SoilMGAYRIDRSGSVDGIVLRSSEDPRPRSKKILMRAGA
Ga0307471_10189218723300032180Hardwood Forest SoilMEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRAS
Ga0310914_1027197013300033289SoilMKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.