Basic Information | |
---|---|
Family ID | F087477 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 42 residues |
Representative Sequence | VLVSAELAAAVGANCRLVPLGCHALRGVREMQEIYGLDLG |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.09 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.727 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.727 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 22.06% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF01717 | Meth_synt_2 | 16.36 |
PF08386 | Abhydrolase_4 | 6.36 |
PF04014 | MazE_antitoxin | 2.73 |
PF01541 | GIY-YIG | 1.82 |
PF01724 | DUF29 | 1.82 |
PF00805 | Pentapeptide | 1.82 |
PF00782 | DSPc | 1.82 |
PF00496 | SBP_bac_5 | 0.91 |
PF00078 | RVT_1 | 0.91 |
PF13459 | Fer4_15 | 0.91 |
PF04367 | DUF502 | 0.91 |
PF00440 | TetR_N | 0.91 |
PF00892 | EamA | 0.91 |
PF07992 | Pyr_redox_2 | 0.91 |
PF00665 | rve | 0.91 |
PF04655 | APH_6_hur | 0.91 |
PF12848 | ABC_tran_Xtn | 0.91 |
PF01590 | GAF | 0.91 |
PF00672 | HAMP | 0.91 |
PF01695 | IstB_IS21 | 0.91 |
PF00296 | Bac_luciferase | 0.91 |
PF02452 | PemK_toxin | 0.91 |
PF13358 | DDE_3 | 0.91 |
PF01548 | DEDD_Tnp_IS110 | 0.91 |
PF00881 | Nitroreductase | 0.91 |
PF12697 | Abhydrolase_6 | 0.91 |
PF13365 | Trypsin_2 | 0.91 |
PF13185 | GAF_2 | 0.91 |
PF01039 | Carboxyl_trans | 0.91 |
PF00561 | Abhydrolase_1 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 16.36 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.82 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.91 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.91 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.91 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.91 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.91 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.91 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.91 |
COG2928 | Uncharacterized membrane protein | Function unknown [S] | 0.91 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.91 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.91 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.64 % |
Unclassified | root | N/A | 16.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004082|Ga0062384_100821145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 651 | Open in IMG/M |
3300004633|Ga0066395_10019016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2699 | Open in IMG/M |
3300005437|Ga0070710_11182091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300005458|Ga0070681_11711877 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005559|Ga0066700_10553395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
3300005561|Ga0066699_10911937 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005764|Ga0066903_102446929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
3300005764|Ga0066903_102585177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
3300005764|Ga0066903_107101127 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300006031|Ga0066651_10048190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1984 | Open in IMG/M |
3300006176|Ga0070765_101646446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300006804|Ga0079221_10591450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
3300009094|Ga0111539_10607760 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300009176|Ga0105242_11429004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
3300010046|Ga0126384_11133615 | Not Available | 718 | Open in IMG/M |
3300010321|Ga0134067_10440683 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010358|Ga0126370_10645195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
3300010361|Ga0126378_10115290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2680 | Open in IMG/M |
3300010362|Ga0126377_11823219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
3300010362|Ga0126377_12714018 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010398|Ga0126383_10224621 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300012056|Ga0153925_1030879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300012210|Ga0137378_10739529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
3300012211|Ga0137377_11501239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
3300012357|Ga0137384_10465603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
3300012361|Ga0137360_11184370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
3300012363|Ga0137390_10206097 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
3300012363|Ga0137390_10767801 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300013306|Ga0163162_10515144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1326 | Open in IMG/M |
3300014271|Ga0075326_1016116 | Not Available | 1808 | Open in IMG/M |
3300016270|Ga0182036_11036899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
3300016294|Ga0182041_11258009 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300016341|Ga0182035_10755165 | Not Available | 851 | Open in IMG/M |
3300016341|Ga0182035_11533692 | Not Available | 600 | Open in IMG/M |
3300016371|Ga0182034_10667169 | Not Available | 882 | Open in IMG/M |
3300016371|Ga0182034_10950165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
3300016445|Ga0182038_11877337 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300017936|Ga0187821_10031439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1875 | Open in IMG/M |
3300017961|Ga0187778_10904962 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300020580|Ga0210403_10886231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
3300021088|Ga0210404_10827041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thiophilum | 529 | Open in IMG/M |
3300021388|Ga0213875_10273549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
3300021444|Ga0213878_10035296 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
3300021444|Ga0213878_10298639 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300021478|Ga0210402_10440991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1209 | Open in IMG/M |
3300021560|Ga0126371_10670006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1186 | Open in IMG/M |
3300021560|Ga0126371_12075023 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300021560|Ga0126371_12670048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.2 | 605 | Open in IMG/M |
3300022529|Ga0242668_1059337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300022533|Ga0242662_10244369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300025916|Ga0207663_10503213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81 | 941 | Open in IMG/M |
3300025923|Ga0207681_11707062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thiophilum | 526 | Open in IMG/M |
3300025941|Ga0207711_11988001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thiophilum | 524 | Open in IMG/M |
3300027307|Ga0209327_1000374 | Not Available | 3710 | Open in IMG/M |
3300027869|Ga0209579_10593574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300031057|Ga0170834_112047076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C-145 | 681 | Open in IMG/M |
3300031446|Ga0170820_16243484 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300031545|Ga0318541_10248859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
3300031545|Ga0318541_10527153 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300031561|Ga0318528_10321448 | Not Available | 831 | Open in IMG/M |
3300031564|Ga0318573_10046894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2095 | Open in IMG/M |
3300031573|Ga0310915_11075413 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031680|Ga0318574_10056542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2079 | Open in IMG/M |
3300031680|Ga0318574_10428244 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300031681|Ga0318572_10866815 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031682|Ga0318560_10049136 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
3300031682|Ga0318560_10276536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 904 | Open in IMG/M |
3300031708|Ga0310686_103455775 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300031719|Ga0306917_10484476 | Not Available | 970 | Open in IMG/M |
3300031723|Ga0318493_10485659 | Not Available | 682 | Open in IMG/M |
3300031726|Ga0302321_103079894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300031747|Ga0318502_10483659 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300031751|Ga0318494_10106257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1552 | Open in IMG/M |
3300031765|Ga0318554_10155000 | Not Available | 1301 | Open in IMG/M |
3300031768|Ga0318509_10335110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 847 | Open in IMG/M |
3300031770|Ga0318521_10011080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3880 | Open in IMG/M |
3300031777|Ga0318543_10413328 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300031779|Ga0318566_10204888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
3300031779|Ga0318566_10660658 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031795|Ga0318557_10213205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300031795|Ga0318557_10554209 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031797|Ga0318550_10117349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
3300031797|Ga0318550_10391077 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300031821|Ga0318567_10646759 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031833|Ga0310917_11206418 | Not Available | 503 | Open in IMG/M |
3300031846|Ga0318512_10361581 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300031910|Ga0306923_12272911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
3300031912|Ga0306921_10228108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 2182 | Open in IMG/M |
3300031912|Ga0306921_11021564 | Not Available | 931 | Open in IMG/M |
3300031912|Ga0306921_11372629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 778 | Open in IMG/M |
3300031912|Ga0306921_12301427 | Not Available | 565 | Open in IMG/M |
3300031941|Ga0310912_10219176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1458 | Open in IMG/M |
3300031942|Ga0310916_11403885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300031945|Ga0310913_10190133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1431 | Open in IMG/M |
3300031945|Ga0310913_10600506 | Not Available | 780 | Open in IMG/M |
3300031947|Ga0310909_10046944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3298 | Open in IMG/M |
3300031947|Ga0310909_10067684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2797 | Open in IMG/M |
3300031954|Ga0306926_10087608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3798 | Open in IMG/M |
3300031954|Ga0306926_12787580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300032001|Ga0306922_11954689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300032025|Ga0318507_10306006 | Not Available | 691 | Open in IMG/M |
3300032039|Ga0318559_10032665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2091 | Open in IMG/M |
3300032044|Ga0318558_10392456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300032059|Ga0318533_10195674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1446 | Open in IMG/M |
3300032063|Ga0318504_10237926 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300032064|Ga0318510_10459176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300032090|Ga0318518_10223580 | Not Available | 965 | Open in IMG/M |
3300032091|Ga0318577_10437372 | Not Available | 625 | Open in IMG/M |
3300032094|Ga0318540_10264529 | Not Available | 830 | Open in IMG/M |
3300032094|Ga0318540_10462430 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.18% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.82% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.91% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012056 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaG | Host-Associated | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062384_1008211452 | 3300004082 | Bog Forest Soil | VLVSAEFAAAVTNHRRLRPLGRHRLRGVREAREVYALDLDTYE* |
Ga0066395_100190163 | 3300004633 | Tropical Forest Soil | EAFCEPLGRQVLVSAELAAAVGANCRLVPLGCHALRGVREMQEIYGLDLGQLQSSVAL* |
Ga0070710_111820911 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVSAEFAAAAGSGNGLHPMGHHRLRGVREPRAIYGLDL* |
Ga0070681_117118772 | 3300005458 | Corn Rhizosphere | GHNLLVSAEFAEAVGHSHRLRSLGRHTLRGVREPQEIYGLEPRA* |
Ga0066700_105533951 | 3300005559 | Soil | LGRKVLVSAEFAAAAGSCNGLQPLGHHRLRGVRELRPIYALDL* |
Ga0066699_109119371 | 3300005561 | Soil | VLVSAEFAAATGISPRLTSLGRHELRGVRELREVYGLDLGS* |
Ga0066903_1024469291 | 3300005764 | Tropical Forest Soil | VLVSAELAAAVGANCRLVPLGCHALRGVREMQEIYGLDLG* |
Ga0066903_1025851773 | 3300005764 | Tropical Forest Soil | CEPLGRNVLVSVEFAEAIGSFEGLQSLGHHRLRGVREPRAIYGLEL* |
Ga0066903_1071011271 | 3300005764 | Tropical Forest Soil | RNVLVSAELALAAGRDGRLVPLGRYSLRGIREARAIYGLE* |
Ga0066651_100481901 | 3300006031 | Soil | RRVLVSAEFAAATGISPRLTSLGRHELRGVRELREVYGLDLGS* |
Ga0070765_1016464462 | 3300006176 | Soil | RKVLVSAEFAAAAGSCTGLQPLGHHRLRGVREPRAIYGLDV* |
Ga0079221_105914503 | 3300006804 | Agricultural Soil | GRKVLVSAEFAATAGSCNGLQPLGHHRLRGVREPRAIYGLDL* |
Ga0111539_106077602 | 3300009094 | Populus Rhizosphere | LISAALAVAVSDRSRLVRLGYHILRGVREPREIYALDLGLTD* |
Ga0105242_114290042 | 3300009176 | Miscanthus Rhizosphere | CEPLGRKVLVSEEFVTAAGTCNELQPLGHHRLRGVREPRAIYGLNL* |
Ga0126384_111336151 | 3300010046 | Tropical Forest Soil | AELAAAVGEDCRLVPLGLHTLRGVREAREVYGLEFV* |
Ga0134067_104406831 | 3300010321 | Grasslands Soil | AEFAAAVGDVGRLQPLGRHTLRGVREPREIYGVVVGR* |
Ga0126370_106451951 | 3300010358 | Tropical Forest Soil | EPLGRKVLVSADLAAAVGYDCRLVPLGQHRLRGVREPREIYGLELV* |
Ga0126378_101152901 | 3300010361 | Tropical Forest Soil | SAEFALAAGTCTGLRPLGRHRLRGVREPRAVHALDL* |
Ga0126377_118232192 | 3300010362 | Tropical Forest Soil | AFCEPLGRQVLVSAELAAAVGANCRLVPLGRHALRGVRGMQEIYGLDLGQLQSSVAL* |
Ga0126377_127140181 | 3300010362 | Tropical Forest Soil | KVLVSAELAAVIGEDDRLVPLGSHALRGVREPREIFGVDLG* |
Ga0126383_102246211 | 3300010398 | Tropical Forest Soil | PLGRQVLVSAELAAAVGANCRLVPLGRHALRGVRGMQEIYA* |
Ga0153925_10308792 | 3300012056 | Attine Ant Fungus Gardens | KVLVSAEFAAAAGACIGLQPLGRHRLRGVRETRAIYGLDV* |
Ga0137378_107395292 | 3300012210 | Vadose Zone Soil | SAEFAAALGDSARLQPLGRHALRGVREPREIYAPEAGS* |
Ga0137377_115012392 | 3300012211 | Vadose Zone Soil | RNVLVSAEFAAALGDGVRLEPLGRHALRGVREPREIYAPEAGS* |
Ga0137384_104656032 | 3300012357 | Vadose Zone Soil | NVLVSAEFAAALGDGARLQPLGRHALRGVREPREIYSPEAGS* |
Ga0137360_111843701 | 3300012361 | Vadose Zone Soil | LVSAELAAAVGNGCRLEPLGRHTLRGLREPREIYGLDLGSRF* |
Ga0137390_102060974 | 3300012363 | Vadose Zone Soil | AEFAAAAGDSRRLQPLGYHRLRGVREPRAIYGLDLY* |
Ga0137390_107678011 | 3300012363 | Vadose Zone Soil | LGRNVLVSAEFAAALGDSVRLQPLGRHALRGVREPREIYAPEAAS* |
Ga0163162_105151441 | 3300013306 | Switchgrass Rhizosphere | NLLGSAEFAEAVGDSHRLRSLGRHTLRGVREPQEIYGLEPRA* |
Ga0075326_10161161 | 3300014271 | Natural And Restored Wetlands | RKVLVSAELAAVVGDRRRLEPLGTHVLRGVRAPRKIYGLDLGFKP* |
Ga0182036_110368993 | 3300016270 | Soil | VLVSAEFAAAAESSTGLQPLGHHRLRGVRELRAIYGLHV |
Ga0182041_112580092 | 3300016294 | Soil | LVSAELAAVVGNSRHLEPLGHHRLRGVRDARVIYGLDL |
Ga0182035_107551653 | 3300016341 | Soil | VLVSAELAAVVADKCRLVPVGYHTLRGIREMREIYGLELG |
Ga0182035_115336921 | 3300016341 | Soil | ILVSAELAAAVGDSHCLQPLGRHRLRGVSEPRAIYALEF |
Ga0182034_106671691 | 3300016371 | Soil | VLVSAELAAAVGESCRLVPLGRHVLRGVREVREIYGLEIG |
Ga0182034_109501653 | 3300016371 | Soil | RSVLVSAEFAEAIGSFEGLQFLGHHRLRGVREPRAIYGLEL |
Ga0182038_118773372 | 3300016445 | Soil | KVLVSAELAATVGESRRLVLLGCHKLRGVGEMREVYGLELG |
Ga0187821_100314391 | 3300017936 | Freshwater Sediment | LVSAEFAAAAEQPDRLVSLGEHLLRGVREPREIFGLVRE |
Ga0187778_109049622 | 3300017961 | Tropical Peatland | VLVSAEFAAAARDPGRLRRLGRHPLRGVRDEREIFALAAIPAR |
Ga0210403_108862313 | 3300020580 | Soil | LVSAEFAAAAGSCNGLQPLGHHRLRGVREPRAIYGLDL |
Ga0210404_108270413 | 3300021088 | Soil | VSAEFAAALGDSPRLQPLGHHALRGVRETREIYALDLDA |
Ga0213875_102735493 | 3300021388 | Plant Roots | EPLGRNVLVSAEFADATGSFEGLQFLGHHRLRGVREPRAIYGLEL |
Ga0213878_100352961 | 3300021444 | Bulk Soil | ELAAAVGDSHRLKPLGRHRLRGVSEPRAIYALAPLG |
Ga0213878_102986392 | 3300021444 | Bulk Soil | LGHRILVSAELAAAVGNSHQLKPLGRHRLRGVSEPRAIYALEF |
Ga0210402_104409914 | 3300021478 | Soil | KVLVSAEFAAAAGSCNGLQPLGHYRLRGVRAPRAIYGLDL |
Ga0126371_106700062 | 3300021560 | Tropical Forest Soil | TLCEPLGRQVLISAELASVVGDNPRLVPLGRHALRGVREPREIYGLELT |
Ga0126371_120750232 | 3300021560 | Tropical Forest Soil | QVLVSAELAAAVGANRRLVPLGCHALRGVREMQEIYGLDLG |
Ga0126371_126700481 | 3300021560 | Tropical Forest Soil | VSAELAAAVGDDPHLYSLGSHTLRGVREGRELYGLSLG |
Ga0242668_10593373 | 3300022529 | Soil | KVLVSAEFAAAAGSCHGLQPLGHHPLRGVREPRAIYGLDV |
Ga0242662_102443691 | 3300022533 | Soil | EPLGRKVLVSAEFAAAAGSCNGLQPLGHHRLRGVREPRAIYGLDL |
Ga0207663_105032131 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NMLVSAAFARALADPARLTSLGHHDLRGVREPREIFAVVAGE |
Ga0207681_117070621 | 3300025923 | Switchgrass Rhizosphere | LGRNLLVSAEFAAAVCDRARLRPLRRHTLRGVREPREIYGLEPD |
Ga0207711_119880011 | 3300025941 | Switchgrass Rhizosphere | LGRNLLVSAEFAAAVGDRARLRPLGRRTLRGVREPREIYGLEPG |
Ga0209327_10003741 | 3300027307 | Forest Soil | LGRSVLLSAELAAAVEPDHRLVPLGRHTLRGVREPHAIYALESGASSGS |
Ga0209579_105935742 | 3300027869 | Surface Soil | ASATLAGAVGDKRRLASLGRHALRGVREPREVYALTLGS |
Ga0170834_1120470762 | 3300031057 | Forest Soil | LGCQVLVSAELAAAVDANCRLVPLGRHALRGVREMQEIYGLDFG |
Ga0170820_162434841 | 3300031446 | Forest Soil | EALCEPLGCQVLVSAELAAAVDANCRLVHLGRHALRGVREMQEIYGLDLG |
Ga0318541_102488592 | 3300031545 | Soil | EPLDRKVLVSAELAAAVGASCRLVPLGHHELRGVREPREIYGLELG |
Ga0318541_105271531 | 3300031545 | Soil | TLCEPLGRRVLVSAELAAAVGDSHRLEALGCHRLRGVSEPRAIYALEL |
Ga0318528_103214481 | 3300031561 | Soil | AELASVLGDNPRLVPLGRHALRGVREPREIYGLEIV |
Ga0318573_100468943 | 3300031564 | Soil | LVSAELAAAVGESRRLVPLGRHALRGVREVREIYGLEIG |
Ga0310915_110754131 | 3300031573 | Soil | LGRQVLVSAELAAALGESRRLVPLGKHELRGVREPREIYGLDLG |
Ga0318574_100565422 | 3300031680 | Soil | PLGRKVLVSADLAAAVGYDCRLVPLGQHRLRGVREPRKIYGLKLG |
Ga0318574_104282441 | 3300031680 | Soil | VLVSAELAAVVGNSRHLEPLGHHRLRGVRDARVIYGLDL |
Ga0318572_108668151 | 3300031681 | Soil | LVSEELATAVGESRRLVPLGRHKLRGVRDVREVYGLELG |
Ga0318560_100491364 | 3300031682 | Soil | GYKVLVSADLAAAADDHCRLGALGHHRLRGVREPRAIYALIF |
Ga0318560_102765361 | 3300031682 | Soil | VLVSADLAAAVGYDCRLVPLGYHALRGVHEPREIYGLDIS |
Ga0310686_1034557753 | 3300031708 | Soil | GHNVLVSAEFSDAVTDNRRLLPLGRHRLRGVREESEVYALDLGAED |
Ga0306917_104844762 | 3300031719 | Soil | EFAAAVGDSGRLVPLGRHTLRGVREMQEIYGLDLG |
Ga0318493_104856591 | 3300031723 | Soil | ELAAAVGANCSLIPLGCHTLRGVREMQEIYGLDLG |
Ga0302321_1030798941 | 3300031726 | Fen | SADLAAAAGPGAGRLVPLGRHRLRGVREVGEIYALTV |
Ga0318502_104836591 | 3300031747 | Soil | VLVSAELAAEVADTHRLQLLGEHSLRGVREPRAIYALIF |
Ga0318494_101062573 | 3300031751 | Soil | VLVSAELTAAVGASCRLVPLGQHTLRGVREMREIYGLELG |
Ga0318554_101550002 | 3300031765 | Soil | SAELAAVVGDSCRLVPLGHHELRGVREPREIYGLELG |
Ga0318509_103351101 | 3300031768 | Soil | PLGRKVLVSADLAAAVGYDCRLVPLGYHALRGVHEPREIYGLDIS |
Ga0318521_100110804 | 3300031770 | Soil | LGRKVLVSADLAAAVGYDCRLVPLGQHRLRGVREPRKIYGLKLG |
Ga0318543_104133281 | 3300031777 | Soil | KVLVSADLAAAADDNCRLEPLGHHRLRGVREPRAIYALIF |
Ga0318566_102048881 | 3300031779 | Soil | PLDRKVLVSAELAAAVGASCRLVPLGHHELRGVREPREIYGLELG |
Ga0318566_106606582 | 3300031779 | Soil | RVLVSAELAAAVGESRRLVPLGRHALRGVREVREIYGLEIG |
Ga0318557_102132053 | 3300031795 | Soil | IEGLCEPLGYQVLVSAELAAAVDASCRLVPLGCHALRGVREMQEIYGVDHLG |
Ga0318557_105542092 | 3300031795 | Soil | LGRKVLVSAELAAAVGESCRLVPLGRHVLRGVREVREIYGLEIG |
Ga0318550_101173492 | 3300031797 | Soil | LVSAELAAAVGDRCRLEPLGRHTLRGVREAREIYGLELG |
Ga0318550_103910771 | 3300031797 | Soil | GRTVLVSAELAAVVGNSRRLEPLGHHRLRGVRDARVIYGLDL |
Ga0318567_106467592 | 3300031821 | Soil | EPLGRKVLVSAELAATVGESRRLVLLGCHKLRGVGEMREVYGLELG |
Ga0310917_112064181 | 3300031833 | Soil | PLGCQVLVSAELAAAVGANRRLVPLGCHALRGVREMQEIYGLDLG |
Ga0318512_103615811 | 3300031846 | Soil | LDRKVLVSAELAAAVGASCRLVPLGHHELRGVREPREIYGLEIV |
Ga0306923_122729112 | 3300031910 | Soil | SADLAAAVGYDCRLVPLGQHRLRGVREPREIYGLELV |
Ga0306921_102281084 | 3300031912 | Soil | ALCEPLGCQVLVSAELAAAVGANRRLVPLGCHALRGVREMQEIYRLDLG |
Ga0306921_110215641 | 3300031912 | Soil | VSAEFAAAVGDSGRLVPLGRHTLRGVREMQEIYGLDLG |
Ga0306921_113726291 | 3300031912 | Soil | KVLVSADLAAAVGYDCRLVPLGQHRLRGVREPREIYGLELV |
Ga0306921_123014272 | 3300031912 | Soil | IEVLCEPLGRRVLVSAELAAVVADKCRLVPVGHHTLKGIREMREIYGLELG |
Ga0310912_102191761 | 3300031941 | Soil | SAELAAAVSANRRLVPLGCHALRGVREMQEIYGLDLG |
Ga0310916_114038851 | 3300031942 | Soil | VSAELASVVGDSCRLVPLGHHELRGVREPREIYGLDLGSRP |
Ga0310913_101901333 | 3300031945 | Soil | ELAAAVDANCHLVPLGCHALRGVREMQEIHGLDLG |
Ga0310913_106005061 | 3300031945 | Soil | AELAAAVGANRRLVPLGCHALRGVREMQEIYGLDLG |
Ga0310909_100469441 | 3300031947 | Soil | EMAAATGDSCRLVPLGRHKLRGVSEAREIYGLEIA |
Ga0310909_100676841 | 3300031947 | Soil | EPLGCQVLVSAELAAAVGANRRLVPLGCHPLRGVREMQEIYGLDLG |
Ga0306926_100876081 | 3300031954 | Soil | PLGRQVLVSAELAAALGESRRLVPLGKHELRGVREPREIYGLDLG |
Ga0306926_127875801 | 3300031954 | Soil | LVSAELAAALGESRRLVPLGRHQLRGVREPREIYGLEPG |
Ga0306922_119546892 | 3300032001 | Soil | LGHRILVSAELVAAVGDSHRLEPLGRHRLRGVSEPRAIYALEL |
Ga0318507_103060062 | 3300032025 | Soil | VLVSAELAAAVDANCHLVPLGCHALRGVREMQEIHGLDLG |
Ga0318559_100326653 | 3300032039 | Soil | METLCEPLGRQVLVSAELAAALGESRRLVPLGKHELRGVREPREIYGLDLG |
Ga0318558_103924563 | 3300032044 | Soil | PLGRKVLVSAEFAAAAESSTGLQPLGHHRLRGVREPRAIYGLEL |
Ga0318533_101956741 | 3300032059 | Soil | PLGRQVLISAELAAAVGANCRLIPLGFHALRGVREMQEIYGLDLG |
Ga0318504_102379261 | 3300032063 | Soil | LDRKVLVSAELAAAVGASCRLVPLGHHELRGVREPREIYGLELG |
Ga0318510_104591762 | 3300032064 | Soil | LVSAEFAEAIGSFEGLQFLGHHRLRGVREPRAIYGLEL |
Ga0318518_102235802 | 3300032090 | Soil | AELAAAVGANRRLVPLGCHALRGVREMQEIYRLDLG |
Ga0318577_104373721 | 3300032091 | Soil | AELAAAVGANCSLIPLGCHTLRGVREMQEIYGLDLG |
Ga0318540_102645291 | 3300032094 | Soil | LCEPLGCQVLVSAELAAAVDANCRLVPLGCHALRGVREMQEIHGLDLG |
Ga0318540_104624301 | 3300032094 | Soil | PLGRSVLVSAELAAALGESRRLVPLGRHELRGVREPREIYGLDFG |
⦗Top⦘ |