


| Basic Information | |
|---|---|
| Family ID | F087450 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 48 residues |
| Representative Sequence | TGFIQMAIGAAAAQLGGHVIAHAPDAMPMLLLMLLFGVATAVAVWTLVRR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02738 | MoCoBD_1 | 40.91 |
| PF11752 | DUF3309 | 24.55 |
| PF12826 | HHH_2 | 10.00 |
| PF00533 | BRCT | 6.36 |
| PF09084 | NMT1 | 4.55 |
| PF13493 | DUF4118 | 2.73 |
| PF02789 | Peptidase_M17_N | 0.91 |
| PF01613 | Flavin_Reduct | 0.91 |
| PF13379 | NMT1_2 | 0.91 |
| PF08327 | AHSA1 | 0.91 |
| PF03466 | LysR_substrate | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.55 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.55 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.91 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.64 % |
| Unclassified | root | N/A | 26.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101454186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 606 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100058662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3521 | Open in IMG/M |
| 3300004152|Ga0062386_100781000 | Not Available | 786 | Open in IMG/M |
| 3300004479|Ga0062595_102421951 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005181|Ga0066678_10458236 | Not Available | 847 | Open in IMG/M |
| 3300005332|Ga0066388_102672820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300005332|Ga0066388_103576680 | Not Available | 793 | Open in IMG/M |
| 3300005332|Ga0066388_104519910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708 | Open in IMG/M |
| 3300005332|Ga0066388_104817448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300005332|Ga0066388_104874217 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005332|Ga0066388_106081382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300005340|Ga0070689_100034535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3858 | Open in IMG/M |
| 3300005434|Ga0070709_10048548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2649 | Open in IMG/M |
| 3300005439|Ga0070711_100352116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300005455|Ga0070663_100050747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2952 | Open in IMG/M |
| 3300005466|Ga0070685_11528888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300005536|Ga0070697_101116312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300005539|Ga0068853_100864454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 868 | Open in IMG/M |
| 3300005713|Ga0066905_100747841 | Not Available | 843 | Open in IMG/M |
| 3300005764|Ga0066903_102325076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1036 | Open in IMG/M |
| 3300005764|Ga0066903_103108931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300005764|Ga0066903_103205527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300005764|Ga0066903_106728730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300006028|Ga0070717_11313523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300006048|Ga0075363_100643632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300006178|Ga0075367_10068093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2135 | Open in IMG/M |
| 3300006604|Ga0074060_11910473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300006854|Ga0075425_100168226 | Not Available | 2516 | Open in IMG/M |
| 3300006854|Ga0075425_102471366 | Not Available | 575 | Open in IMG/M |
| 3300006880|Ga0075429_101544068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 577 | Open in IMG/M |
| 3300007076|Ga0075435_100269955 | Not Available | 1451 | Open in IMG/M |
| 3300009038|Ga0099829_10611332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 906 | Open in IMG/M |
| 3300009038|Ga0099829_10873754 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009090|Ga0099827_10373310 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300009147|Ga0114129_10820473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1185 | Open in IMG/M |
| 3300009162|Ga0075423_11986327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300010361|Ga0126378_10936978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300010373|Ga0134128_10197895 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300012096|Ga0137389_11817831 | Not Available | 505 | Open in IMG/M |
| 3300012204|Ga0137374_10861395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300012209|Ga0137379_11026726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 730 | Open in IMG/M |
| 3300012211|Ga0137377_10504243 | Not Available | 1148 | Open in IMG/M |
| 3300012212|Ga0150985_100715524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1994 | Open in IMG/M |
| 3300012355|Ga0137369_10438931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300012358|Ga0137368_10999815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012905|Ga0157296_10417219 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012922|Ga0137394_10712387 | Not Available | 844 | Open in IMG/M |
| 3300012923|Ga0137359_10893215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300012924|Ga0137413_11428473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300012951|Ga0164300_10238348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300012957|Ga0164303_11153558 | Not Available | 563 | Open in IMG/M |
| 3300012984|Ga0164309_11077982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300012987|Ga0164307_10117484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1698 | Open in IMG/M |
| 3300012989|Ga0164305_10110231 | Not Available | 1788 | Open in IMG/M |
| 3300013297|Ga0157378_10850122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300015356|Ga0134073_10246290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300015372|Ga0132256_103187434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300016341|Ga0182035_10609990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300016387|Ga0182040_11929156 | Not Available | 507 | Open in IMG/M |
| 3300016422|Ga0182039_11813256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300018469|Ga0190270_10413290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
| 3300019887|Ga0193729_1267083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300020581|Ga0210399_11277372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300020583|Ga0210401_11231365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Martelella → Martelella mediterranea | 607 | Open in IMG/M |
| 3300021168|Ga0210406_10186059 | Not Available | 1728 | Open in IMG/M |
| 3300021401|Ga0210393_11612143 | Not Available | 514 | Open in IMG/M |
| 3300021560|Ga0126371_13290043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300021560|Ga0126371_13502170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300025903|Ga0207680_10039077 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300025909|Ga0207705_11083013 | Not Available | 618 | Open in IMG/M |
| 3300025922|Ga0207646_11623240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300025981|Ga0207640_11507673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300027381|Ga0208983_1021553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1258 | Open in IMG/M |
| 3300027576|Ga0209003_1005615 | Not Available | 1722 | Open in IMG/M |
| 3300027643|Ga0209076_1193886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300027684|Ga0209626_1205517 | Not Available | 522 | Open in IMG/M |
| 3300027738|Ga0208989_10004659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4598 | Open in IMG/M |
| 3300028536|Ga0137415_10078494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3161 | Open in IMG/M |
| 3300028708|Ga0307295_10116766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
| 3300028712|Ga0307285_10092464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300028717|Ga0307298_10180199 | Not Available | 619 | Open in IMG/M |
| 3300028721|Ga0307315_10201851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300031549|Ga0318571_10016867 | Not Available | 1849 | Open in IMG/M |
| 3300031668|Ga0318542_10126176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1256 | Open in IMG/M |
| 3300031681|Ga0318572_10730258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300031682|Ga0318560_10666905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300031682|Ga0318560_10709860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300031723|Ga0318493_10052033 | Not Available | 1940 | Open in IMG/M |
| 3300031736|Ga0318501_10055740 | Not Available | 1864 | Open in IMG/M |
| 3300031736|Ga0318501_10323625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
| 3300031744|Ga0306918_10307601 | Not Available | 1222 | Open in IMG/M |
| 3300031748|Ga0318492_10145602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1192 | Open in IMG/M |
| 3300031748|Ga0318492_10239474 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031765|Ga0318554_10018722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3585 | Open in IMG/M |
| 3300031769|Ga0318526_10477303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031778|Ga0318498_10151198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1056 | Open in IMG/M |
| 3300031835|Ga0318517_10225364 | Not Available | 845 | Open in IMG/M |
| 3300031897|Ga0318520_10898467 | Not Available | 558 | Open in IMG/M |
| 3300031910|Ga0306923_10543933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1309 | Open in IMG/M |
| 3300031940|Ga0310901_10223229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
| 3300031959|Ga0318530_10036247 | Not Available | 1796 | Open in IMG/M |
| 3300031959|Ga0318530_10082865 | Not Available | 1256 | Open in IMG/M |
| 3300032008|Ga0318562_10049873 | Not Available | 2294 | Open in IMG/M |
| 3300032010|Ga0318569_10037473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2051 | Open in IMG/M |
| 3300032041|Ga0318549_10255677 | Not Available | 789 | Open in IMG/M |
| 3300032051|Ga0318532_10121789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300032055|Ga0318575_10213085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 971 | Open in IMG/M |
| 3300032076|Ga0306924_10939983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 953 | Open in IMG/M |
| 3300032205|Ga0307472_100463868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1081 | Open in IMG/M |
| 3300033551|Ga0247830_10346442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014541861 | 3300000364 | Soil | QMAIGAVAAQFGGHVVAQATDAIPLLLLMLGFGVATGVAVFALVRK* |
| JGIcombinedJ26739_1000586621 | 3300002245 | Forest Soil | ASGMTGFIQMLIGAAGAQLSGHVLAGASTAMPMLLLMLVFGMATGGAAFTLITRHPTPR* |
| Ga0062386_1007810002 | 3300004152 | Bog Forest Soil | QMLIGAAGAQLSGHVLAGASTAMPMLLLMLLFGIATGGAAFTLITRFPAPRLN* |
| Ga0062595_1024219511 | 3300004479 | Soil | AAQLSGHAIAGAADAMPMLLLMLLFGFATAAAFLALVRRRA* |
| Ga0066678_104582362 | 3300005181 | Soil | IQMAIAAAAAQLGGHVTAHASDAMPMLLLMLTFGVATAVAVWTLVRR* |
| Ga0066388_1026728201 | 3300005332 | Tropical Forest Soil | VTGFIQMAIGAAAAQLGGQVVAHAAGGMPMLLLMLAFGIATAIAVFTLVRR* |
| Ga0066388_1035766802 | 3300005332 | Tropical Forest Soil | TGFIQMAIGAIAAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR* |
| Ga0066388_1045199102 | 3300005332 | Tropical Forest Soil | GTASGATGFIQMAIGAAAAQLGGHVIAHAPDAMPMLLLMLMFGVATAVAVFSLVRR* |
| Ga0066388_1048174481 | 3300005332 | Tropical Forest Soil | AAQLGGHVVVQATDAVPMLVLMLAFGVATGVAVFALVRH* |
| Ga0066388_1048742172 | 3300005332 | Tropical Forest Soil | VGAAAAQLGGHVTAHASDGMPMLLLMLSFGIATGVAVFTLVSRTRSS* |
| Ga0066388_1060813821 | 3300005332 | Tropical Forest Soil | MAIGAAAAQLGGHVVAHAAGGMPMLLLMLAFGIATAVAVFTLVRR* |
| Ga0070689_1000345354 | 3300005340 | Switchgrass Rhizosphere | IGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR* |
| Ga0070709_100485481 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TASGLTGFIQMSVGALAAQLGGHVVAQAASATPMLLLILFFGIALAVAFFALVRR* |
| Ga0070711_1003521161 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GFIQMLIGAAGAQLSGHVLAGASTAMPLLLLMLVFGMATGGAAFTLITRHPAPR* |
| Ga0070663_1000507471 | 3300005455 | Corn Rhizosphere | FVQMAIGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR* |
| Ga0070685_115288881 | 3300005466 | Switchgrass Rhizosphere | AAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR* |
| Ga0070697_1011163122 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IQMSVGALAAQLGGHVVAQAASATPMLLLMLFFGIALAAAFFALVRR* |
| Ga0068853_1008644543 | 3300005539 | Corn Rhizosphere | GFVQMAIGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR* |
| Ga0066905_1007478411 | 3300005713 | Tropical Forest Soil | AAAQLGGHVVAHAAGGMPMLLLMLAFGIATAIAVFTLVRR* |
| Ga0066903_1023250761 | 3300005764 | Tropical Forest Soil | SGLTGFIQMAIGGAAAQLGGYVVAQATDAVPMLVLMLGFGVATGVAVFALVRR* |
| Ga0066903_1031089311 | 3300005764 | Tropical Forest Soil | QMSIGAVAAQLGGYVVAQAAGATPMLLLMLFFGIATAAAVFTLVRR* |
| Ga0066903_1032055271 | 3300005764 | Tropical Forest Soil | ATAAQLGGYVVAGASDATPMLLLILGFGVATAGAVFTLVTRRPPARSQA* |
| Ga0066903_1067287301 | 3300005764 | Tropical Forest Soil | RPQVAGTASGMTGFIQMAICAGAAQLSGYLVARASNAIPMLLLILIFGLATATAAAVLVRGRWRNS* |
| Ga0070717_113135232 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVTAHASDAMPMLLLMLTFGVATAVAVWTLVRR* |
| Ga0075363_1006436323 | 3300006048 | Populus Endosphere | GLVIAHATGAMPLLLLMLAFGVATGLAVFSLVRR* |
| Ga0075367_100680933 | 3300006178 | Populus Endosphere | AAQLGGLVIAHATGAMPLLLLMLAFGVATGLAVFSLVRR* |
| Ga0074060_119104731 | 3300006604 | Soil | AAAQLGGHVTAHAPDAMPMLLLMLMFGVATAVAVWTLVRR* |
| Ga0075425_1001682261 | 3300006854 | Populus Rhizosphere | ASGLTGFIQMSVGALAAQLGGHVVAQAASATPMLLLILFFGIALAVAFFALVRR* |
| Ga0075425_1024713661 | 3300006854 | Populus Rhizosphere | ASGLTGFIQMSVGALAAQLGGHVVAQAASATPMLLLMLFFGIALAAAFFALVRRPA* |
| Ga0075429_1015440682 | 3300006880 | Populus Rhizosphere | VTGFVQMGIAAVAAQLGGHVIAHAADALPMLLLMLIFGAATAIAVFTLVRR* |
| Ga0075435_1002699551 | 3300007076 | Populus Rhizosphere | GAVAAQLGGYVVAQAAGATPMLLLMLFFGIATAAAVFTLVRR* |
| Ga0099829_106113323 | 3300009038 | Vadose Zone Soil | QMAIGAGAAQLSGHVIAGASDAMPMLLLMLGFGIATAAAVFVLVRRR* |
| Ga0099829_108737542 | 3300009038 | Vadose Zone Soil | MTGFIQMAIGAGAAQLSGHVIGHASDAMPMLLLMLVFGVATAIAVFTLVRWR* |
| Ga0099827_103733102 | 3300009090 | Vadose Zone Soil | QLSGHAIAGASDAMPMLLLMLLFGFATAAAFLALVRRRS* |
| Ga0114129_108204731 | 3300009147 | Populus Rhizosphere | TGFIQMGIAAVAAQLGGHVISHAADALPMLLLMLIFGIATAAAVFALVRR* |
| Ga0075423_119863271 | 3300009162 | Populus Rhizosphere | GATGFIQMAIGAVAAQLGGHVVAHAADAMPMLLLMLFFGIATATAVFTLVRR* |
| Ga0126378_109369782 | 3300010361 | Tropical Forest Soil | TGFIQMAIGAAAAQLGGHVIAHAPDAMPMLLLMLLFGVATAVAVWTLVRR* |
| Ga0134128_101978953 | 3300010373 | Terrestrial Soil | ASGLTGFIQMSVGALAAQLGGHVVAQAASATPMLLLMLFFGIALAAAFFALVRR* |
| Ga0137389_118178313 | 3300012096 | Vadose Zone Soil | GMTGFIQMVIGAGAAQLSGYLIAGASNAMPMLLLMLLFGVATAAAVFALVVRR* |
| Ga0137374_108613951 | 3300012204 | Vadose Zone Soil | VAGTASGVTGFVQMGIAAVAAQLGGHVISHAADALPMLLLMLMFGVATAAAVFTLVRR* |
| Ga0137379_110267261 | 3300012209 | Vadose Zone Soil | KVAAIAAQLGGHVISQATDALPMLLLMLIFGVATAAAVFTLVRR* |
| Ga0137377_105042431 | 3300012211 | Vadose Zone Soil | AAAAQLGGHVTSHAPDAMPMLLLMLTFGVATAVAVWTLVRR* |
| Ga0150985_1007155243 | 3300012212 | Avena Fatua Rhizosphere | GMAGFIQMAIGACAAQLSAHVIAGASSAMPMLLLMLAFAVATAGAVYILVR* |
| Ga0137369_104389312 | 3300012355 | Vadose Zone Soil | AAAAQLGGHVIAHASDAMPMLLLMLMFGIATAIAVWTLVRR* |
| Ga0137368_109998152 | 3300012358 | Vadose Zone Soil | VTGFVQMGIAAVAAQLGGHVIAHAADALPMLLLMLMFGVATAAAVFTLVRR* |
| Ga0157296_104172191 | 3300012905 | Soil | SGLTGFIQMAIGAAAAQLGGLAVAHATDAVPLLLLMLAFGVATAVAVFTLVRR* |
| Ga0137394_107123871 | 3300012922 | Vadose Zone Soil | GTASGTTGFIQMAIAAAAAQLGGHVIAHASDAMPMLLLMLGFGIATAIAVFTLVRR* |
| Ga0137359_108932152 | 3300012923 | Vadose Zone Soil | GVTGFIHMAIGAAAAQLGGQVVAHAAGGTPMLLLMLAFGIATAIAVFSLVRR* |
| Ga0137413_114284731 | 3300012924 | Vadose Zone Soil | AAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAAFSLVRR* |
| Ga0164300_102383481 | 3300012951 | Soil | GFFQMLIGAAGAQLSGHVLAGASTAMPLLLLMLVFGIATGGAAFTLITRHPAPR* |
| Ga0164303_111535582 | 3300012957 | Soil | AAAAQLGGLAVDHATDAVPLLLLMLAFGVATAVAVFTLVRR* |
| Ga0164309_110779821 | 3300012984 | Soil | SGTTGFIQMAIGAAAAQLGGLATAHAPDAMPMLLLMLMFGVATAVAVWTLVRR* |
| Ga0164307_101174841 | 3300012987 | Soil | GAAAAQLGGLAVAHATDAVPLLLLMLAFGVATAVAVFTLVRR* |
| Ga0164305_101102312 | 3300012989 | Soil | SVGALAAQLGGHVVAQAASATPMLLLMLFFGIALAAAFFALVRR* |
| Ga0157378_108501221 | 3300013297 | Miscanthus Rhizosphere | QLGGLAVAHATDAVPLLLLMLAFGVATAVAVFTLVRR* |
| Ga0134073_102462901 | 3300015356 | Grasslands Soil | LGGQVVAHAAGATPMLLLMLAFGIATAIAVFSLVRR* |
| Ga0132256_1031874342 | 3300015372 | Arabidopsis Rhizosphere | MTGFIQMAIGAAAAQLGGLVVAHASGALPMLVLMLAFGVATAIAVFVLVRR* |
| Ga0182035_106099901 | 3300016341 | Soil | AQLGGHVIAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0182040_119291561 | 3300016387 | Soil | PQVAGTASGMTGFIQMAICAGAAQLSGYLVARSSNAIPMLLLILMFGLATATAAAVLVRRRWRTL |
| Ga0182039_118132562 | 3300016422 | Soil | GAIAAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR |
| Ga0190270_104132901 | 3300018469 | Soil | AQLGGLVIAHATSAMPLLLLMLAFGIATAVAVFSLVRR |
| Ga0193729_12670831 | 3300019887 | Soil | SIRPQVAGTASGMTGFIQMLIGAAGAQLSGHVLAGASTAMPMLLLMLVFGIATGGAVFTLITRHPAPR |
| Ga0210399_112773722 | 3300020581 | Soil | TTGFIQMAIGAAAAQLGGLATAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0210401_112313651 | 3300020583 | Soil | SGMTGFIQMLIGAAGAQLSGHVLAGASTAMPLLLLMLVFGMATGGAAFTLITRHPAPR |
| Ga0210406_101860592 | 3300021168 | Soil | ASGTTGFIQMAIGAAAAQLGGLATAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0210393_116121432 | 3300021401 | Soil | ASGMTGFFQMLIGAAGAQLSGHVLAGASTAMPMLLLMLLFGIATGGAAFTLITRFPAPR |
| Ga0126371_132900433 | 3300021560 | Tropical Forest Soil | AAAAQLGGLIVAHATGAMPLILLMLLFGLATAAAFLVLVRR |
| Ga0126371_135021701 | 3300021560 | Tropical Forest Soil | GATGFIQMAIGAAAAQLGGHVIAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0207680_100390774 | 3300025903 | Switchgrass Rhizosphere | MAIGATAAQLGGLVIAHATGAMPLLLLMLAFGVATGLAVFSLVRR |
| Ga0207705_110830131 | 3300025909 | Corn Rhizosphere | MAIGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR |
| Ga0207646_116232402 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQLGGHVTAHASDAMPMLLLMLTFGVATAVAVWTLVRR |
| Ga0207640_115076733 | 3300025981 | Corn Rhizosphere | QLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR |
| Ga0208983_10215533 | 3300027381 | Forest Soil | LGGHIVAHASNALPMMLLMLAFGVATAVAVFTLVRR |
| Ga0209003_10056151 | 3300027576 | Forest Soil | AAQLGGHATAHASDAVPMLLLMLMFGVATAIAVWTLVRR |
| Ga0209076_11938862 | 3300027643 | Vadose Zone Soil | QLGGHVTAHASDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0209626_12055171 | 3300027684 | Forest Soil | TASGMTGFIQMLIGAAGAQLSGHVLAGASTAMPMLLLMLVFGIATGGAVFTLITRHPAPR |
| Ga0208989_100046591 | 3300027738 | Forest Soil | IGAAAAQLGGHIVAHASNALPMMLLMLAFGVATAVAVFTLVRR |
| Ga0137415_100784944 | 3300028536 | Vadose Zone Soil | TGFIQMAIDAAAAQLGGHVTAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0307295_101167663 | 3300028708 | Soil | AAAAQLGGHIVAHASNALPMMLLMLAFGVATAVAVFALVRR |
| Ga0307285_100924641 | 3300028712 | Soil | IGAAAAQLGGLVIAHATSAMPLLLLMLAFGIATAVAVFSLVRR |
| Ga0307298_101801991 | 3300028717 | Soil | AAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR |
| Ga0307315_102018511 | 3300028721 | Soil | AAAQLGGLVIAHATGAMPLLLLMLAFGVATGLAVFSLVRR |
| Ga0318571_100168672 | 3300031549 | Soil | AAAAQLGGNVIAHAQDAMPMLLLMLTFGVATAVAVWTLVRR |
| Ga0318542_101261762 | 3300031668 | Soil | SGVTGFIQMAIGAIAAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR |
| Ga0318572_107302582 | 3300031681 | Soil | AIGAAAAQLGGYVTAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318560_106669051 | 3300031682 | Soil | DGAAAAQLGGYVTAHAPDAMPMLLLILMFGVATAVAVWTLVRR |
| Ga0318560_107098602 | 3300031682 | Soil | GGYVTAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318493_100520332 | 3300031723 | Soil | LGGYVTAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318501_100557401 | 3300031736 | Soil | FVQMAIGAAAAQLGGYATAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318501_103236252 | 3300031736 | Soil | GTASGMTGFIQMTIGAIAAQLSGQIIAGASNAMPMLMLMLFFGCATAAAVFALVRRQQTSMA |
| Ga0306918_103076012 | 3300031744 | Soil | ASGATGFVQMAIGAAAAQLGGYATAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318492_101456021 | 3300031748 | Soil | SGMTGFIQMTICAGAAQLAGHLVARASDAIPMLLLILLFGIATATAAAVLVTRR |
| Ga0318492_102394741 | 3300031748 | Soil | GAIAAQLSGQIIAGASNAMPMLLLMLFFGCATAAAVFALVRRQQTSMA |
| Ga0318554_100187225 | 3300031765 | Soil | AGTASGMTGFIQMTIGAIAAQLSGQIIAGASNAMPMLLLMLFFGCATAAAVFALVRRQQTSMA |
| Ga0318526_104773031 | 3300031769 | Soil | LGGLVTAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318498_101511982 | 3300031778 | Soil | ASGATGFIQMAIAAAAAQLGGNVIAHAPDAMPMLLLMLMFGIATAIAVWTLVRR |
| Ga0318517_102253641 | 3300031835 | Soil | QLGGYATAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318520_108984671 | 3300031897 | Soil | TASGMTGFIQMTIGAVAAQLGGHVVGHAPDAMPMLWLMLFFGIATGVAVFSLVRR |
| Ga0306923_105439333 | 3300031910 | Soil | GMTGFIQMGVGATAAQLGGHVVAGASSAAPMLLVMLGFGVATAVAVFALVTRHSPASGRI |
| Ga0310901_102232291 | 3300031940 | Soil | FVQMAIGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR |
| Ga0318530_100362471 | 3300031959 | Soil | AVAAQLGGHVIAHAPDAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318530_100828651 | 3300031959 | Soil | AAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR |
| Ga0318562_100498732 | 3300032008 | Soil | IQMVIGAAAAQLGGYVTAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318569_100374731 | 3300032010 | Soil | QVAGTASGVTGFIQMAIGAIAAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR |
| Ga0318549_102556771 | 3300032041 | Soil | TGFIQMAIGAIAAQLGGDVIAHAADATPMLLLMLFFGIATATAVFSLVRR |
| Ga0318532_101217891 | 3300032051 | Soil | LGGYATAHASGAMPMLLLMLMFGVATAVAVWTLVRR |
| Ga0318575_102130851 | 3300032055 | Soil | AGTASGMTGFIQMAICAGAAQLSGYLVARASNAIPMLLLILIFGLATATAAAVLVRGRWRNS |
| Ga0306924_109399831 | 3300032076 | Soil | GTASGMTGFIQMGVGATAAQLGGHVVAGASSAAPMLLVMLGFGVATAVAVFALVTRHSPASGRI |
| Ga0307472_1004638681 | 3300032205 | Hardwood Forest Soil | AGTASGATGFIQMATGAAAAQVSGHIVGSASSATPMLLLMLLFGIATGVAVFALVWRNRGGVEL |
| Ga0247830_103464423 | 3300033551 | Soil | TGFVQMAIGAAAAQLGGLVIAHATGAMPLLLLMLAFGVATGVAVFSLVRR |
| ⦗Top⦘ |