| Basic Information | |
|---|---|
| Family ID | F087299 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LSALIISPFNFLANCIANFDFPDAVGPAKRIIFLDKLI |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.82 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.455 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (33.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13180 | PDZ_2 | 47.27 |
| PF13365 | Trypsin_2 | 18.18 |
| PF01715 | IPPT | 3.64 |
| PF10609 | ParA | 1.82 |
| PF09838 | DUF2065 | 0.91 |
| PF07991 | IlvN | 0.91 |
| PF01571 | GCV_T | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 3.64 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.82 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.45 % |
| All Organisms | root | All Organisms | 14.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 33.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.27% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.09% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.09% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.27% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.55% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.73% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.73% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016787 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020302 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX555996-ERR599018) | Environmental | Open in IMG/M |
| 3300020340 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119) | Environmental | Open in IMG/M |
| 3300020341 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555908-ERR599066) | Environmental | Open in IMG/M |
| 3300020366 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025709 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026081 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028267 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_02564370 | 2166559017 | Environmental And Host-Associated | MLSAFIISPLIFLANLIANSDFPEAVGPDIKLFWT |
| GOS24894_103545191 | 3300002033 | Marine | TCMLSALTISPLIFFAKLTAIFDFPEAVGPAIRMILDL |
| Ga0066865_103160112 | 3300005523 | Marine | IISPFNFFAKAMANFDFPEAVGPARRIIFLDKIN* |
| Ga0066370_100609802 | 3300005971 | Marine | CILSALIISPFNFFAKLTASFDFPDAVGPAKRIIFLDKLIYFNT* |
| Ga0066370_102744952 | 3300005971 | Marine | ILSALIISPFIFSANLIAKFDFPEAVGPAKSINFLSKTNLF* |
| Ga0099675_16294351 | 3300006334 | Marine | IISPFNFFANLIAKFDLPEAVGPAKSNNFLDKTNLF* |
| Ga0099953_10234845 | 3300006351 | Marine | MLSALIISPSIFFASLSANLDLPDAVGPEIKIIF* |
| Ga0099953_14187252 | 3300006351 | Marine | SALIISPFNFFAKLIASFDFPDAVGPAKRIIFFDKLIYFNT* |
| Ga0075506_11090852 | 3300006401 | Aqueous | IISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN* |
| Ga0114995_103854972 | 3300009172 | Marine | MLSALIISPLIFWAILIAILDFPEAVGPAIRIICLDKPT* |
| Ga0114997_103185932 | 3300009425 | Marine | MLSALIISPLIFLATLIANFDFPEAVGPAIRMIFLDKPN* |
| Ga0114997_106640731 | 3300009425 | Marine | SLYICMLSALIIFPLIFFATEIASFDFPDAVGPAIRIIFLDKFN* |
| Ga0115003_103041381 | 3300009512 | Marine | MLSALIISPLIFLEISMAIFDLPEAVGPAIRTIFLDKPI* |
| Ga0115000_105164952 | 3300009705 | Marine | CMLSALIISPLVFFAISIASFDLPDAVGPAINMIFLGKLN* |
| Ga0115000_108392791 | 3300009705 | Marine | LIISPLIFFAILIASLDFPEAVGPARRIILLDKSN* |
| Ga0129333_103949852 | 3300010354 | Freshwater To Marine Saline Gradient | SALIISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN* |
| Ga0160422_101789942 | 3300012919 | Seawater | SPFIFSANLIAKFDFPEAVGPAKSINFLSKTNLF* |
| Ga0160423_111821112 | 3300012920 | Surface Seawater | CMLSALMISPFNFLAKCIASFDFPDAVGPANKIIFLDKINLF* |
| Ga0163110_110292372 | 3300012928 | Surface Seawater | SALIISPFNFFASLIARFDLPEAVGPAKSNNFLDETNLF* |
| Ga0163111_100790654 | 3300012954 | Surface Seawater | CMLSALIISPLSFFAKYIANFDFPDAVGPDKRIIFFDKLI* |
| Ga0182080_17515701 | 3300016787 | Salt Marsh | TCILSALIISPLIFLANEMANLDFPEAVGPAIKIILLDKLN |
| Ga0181404_10331511 | 3300017717 | Seawater | ALPIWEGFNFFAKXIASFDFPDAVGPARRIIFLDKVNLS |
| Ga0181404_10994212 | 3300017717 | Seawater | MLSALIISPLIFFAILTAKLDLPDAVGPEIKIILD |
| Ga0181416_10960801 | 3300017731 | Seawater | MLSALIISPLIFLASLIEKLDLPEAVGPEIKIILD |
| Ga0181421_10500451 | 3300017741 | Seawater | ICMLSAFIISPFIFFAKXIANFDFPEAVGPAKRIIFFDKINLF |
| Ga0181402_10886942 | 3300017743 | Seawater | IISPLIFLAISIASLDFPEAVGPARSIIFLDKLILF |
| Ga0181422_12203862 | 3300017762 | Seawater | TCILSALIISPSNFSARYKANLDLPEAVGPAKRIIFFDKINLF |
| Ga0181394_11340452 | 3300017776 | Seawater | IISPFNFFAKXIANFDFPEAVGPAKRIIFFDKTNLF |
| Ga0181395_11044112 | 3300017779 | Seawater | SALIISPFSLFAIXILSFDFPEAVGPAIKIIFLDNTN |
| Ga0181424_101097021 | 3300017786 | Seawater | VVIISQFNFFDKCIASFDFPDAVGPDKRIIFFDNFI |
| Ga0181424_102170261 | 3300017786 | Seawater | LYTCMLSALIMSPFILFANCIASLDFPEAVGPAKRMILLDKANLF |
| Ga0181565_109238081 | 3300017818 | Salt Marsh | LSALIISPLIFLANKMANLDFPEAVGPAIKIIFLDKLN |
| Ga0181581_106628462 | 3300017962 | Salt Marsh | LSALMISPFNFLAKCIASFDFPDAVGPANKIIFLDKINLS |
| Ga0181572_104939282 | 3300018049 | Salt Marsh | SALIISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN |
| Ga0182077_11217251 | 3300019281 | Salt Marsh | CMLSALIISPLIFLAIAMASFDFPDAVGPAISMIFLGKIN |
| Ga0181604_102108371 | 3300020191 | Salt Marsh | ALIISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN |
| Ga0211483_102273781 | 3300020281 | Marine | LSALIISPFNFFAKLIANFDFPDAVGPAKRIIFLDKLIYFNT |
| Ga0211483_102349191 | 3300020281 | Marine | KICMLSALIISPSIFFAKLIANFDFPDAVGPAKRIIFFDKLIYFYT |
| Ga0211483_102625842 | 3300020281 | Marine | LSALIISPFIFSANLIAKFDFPEAVGPAKSINFLSKINLF |
| Ga0211595_10363842 | 3300020302 | Marine | LSALIISQFNFFANFIARFDLPEAVGPAKSNNFLDKINLF |
| Ga0211594_11237021 | 3300020340 | Marine | LSALIISPFNFFAKPIASFDFPDAVGPAKRIIFLDKLIYFHT |
| Ga0211592_11215431 | 3300020341 | Marine | ISPFNFLAKLVASFDFPEAVGPAKRMIFFDKLIYFNT |
| Ga0211489_102324131 | 3300020366 | Marine | IISPFNFLAKLIASFDFPDAVGPAKRIIFFDKLIYFNT |
| Ga0211652_102598351 | 3300020379 | Marine | SALIISPLSFFAKYIANFDFPDAVGPDKRIIFFDKLI |
| Ga0211498_103709272 | 3300020380 | Marine | IISPFIFFAKLIASFDLPQAVGPAKRRIFFDNLIYFNA |
| Ga0211476_101750542 | 3300020381 | Marine | SAFIISPFNFFAKXIASFDFPDAVGPAKRIIFFDKINLF |
| Ga0211686_103315351 | 3300020382 | Marine | CMLSALIISPLIFLAISMAIFDFPEAVGPAISTIFLDKPI |
| Ga0211677_102327532 | 3300020385 | Marine | LYTCMLSALIISPFNFFAKXIANFDFPDAVGPARRMIFLDKVSLS |
| Ga0211583_103383381 | 3300020397 | Marine | ISPFIFFAKXIANFDFPEAVGPAKRIIFFDKINLF |
| Ga0211532_103852812 | 3300020403 | Marine | ILSALIISPFNFLAKLVASFDFPDAVGPAKSIIFFDKLIYFNT |
| Ga0211496_101035771 | 3300020405 | Marine | AFIISPLSFFANXTAKLDLPEAVGPAKSINFLDKIN |
| Ga0211668_102056961 | 3300020406 | Marine | SLKICMLSALIISPFIFFANFNAKFDLPEAVGPARSINFLDKTNLF |
| Ga0211516_103332932 | 3300020413 | Marine | ISPFIFFANSIANFDFPDAVGPANKIIFFDKLIYFYT |
| Ga0211523_103859551 | 3300020414 | Marine | LNSLNNCILSALIISPFSFLAKLVASFDFPDAVGPAKRIIFFDKLIYFNT |
| Ga0211512_102174322 | 3300020419 | Marine | LSAFIISPLIFFANFIASFDFPEAVGPASKIIFFCKSIYFYS |
| Ga0211580_104327851 | 3300020420 | Marine | SAFIISPSNFFANLIANFDFPDAVGPAKSIIFFDKLIYLYA |
| Ga0211620_100929392 | 3300020424 | Marine | ICMLSALIISPSIFFAKLIANFDFPDAVGPAKRIIFFDKLIYFYT |
| Ga0211558_102699791 | 3300020439 | Marine | LKTCMLSAFIISPFNFFANLIARSDFPEAVGPAKSNNFLDKTNLF |
| Ga0211518_103220641 | 3300020440 | Marine | AFTISPLIFFASNKAKLDFPDAVGPAIKIIFFDKLIYFNFTPRYLL |
| Ga0211559_103056082 | 3300020442 | Marine | MLSALMISPFNFLAKCIANFDFPDAVGPANKIIFLDKINLS |
| Ga0211564_103699312 | 3300020445 | Marine | YICMLSAFIISPFNFFAKCIASFDFPEAVGPAKRIIFFDNLI |
| Ga0211574_103518192 | 3300020446 | Marine | SALIISPFNFFAKXSANFDLPEAVGPASKIIFFDKINLF |
| Ga0211638_103708501 | 3300020448 | Marine | CILSALIISPFNFFASHTANFDFPDAVGPAKRIIFLDKLV |
| Ga0211545_101805082 | 3300020452 | Marine | AFTISPLIFFASNKAKLDFPDAVGPAIKIIFFXQIDLF |
| Ga0211548_102083372 | 3300020454 | Marine | YTCMLSALIISPLIFLANCNAILDLPEAVGPAKRIIFFDKLI |
| Ga0211551_103422482 | 3300020456 | Marine | ILSAFIISPLSFFANXIANFDFPDAVGPAKRIIFLDKFN |
| Ga0211514_101451351 | 3300020459 | Marine | MISPLIFLAKSIPVFDFPDAVGPAIRIIFFXKVNFLFKTN |
| Ga0211486_104669642 | 3300020460 | Marine | FIISPFNFFANIIDNLVLPDAVGPAKRIIFFDKLIYFYT |
| Ga0211546_100117961 | 3300020462 | Marine | ICMLSALIISPFNFFAKWIANFDLPEPVGPAIKINFFNNLV |
| Ga0211713_104871962 | 3300020467 | Marine | IISPLSFFANLIANFDFPDAVGPAKRIIFFGNLIYLNA |
| Ga0211577_102134191 | 3300020469 | Marine | LYNCMLSALIISPLILRANIIANFDFPEAVGPAKRIIFFDKINLS |
| Ga0211579_105451232 | 3300020472 | Marine | LITSPFNFLAKXTANLDLPEAVGPAKRIIFFDKINLF |
| Ga0211625_102743912 | 3300020473 | Marine | LSALMISPFNLLANCIASLDFPDAVGPAKRIIFLDKLI |
| Ga0206678_105782472 | 3300021084 | Seawater | LSALIISPFNFLANCIANFDFPDAVGPAKRIIFLDKLI |
| Ga0213868_107343602 | 3300021389 | Seawater | SALIISPLIFLAIAMASFDFPDAVGPAISIIFLGKIN |
| Ga0213866_102187812 | 3300021425 | Seawater | MLSALIISPFNFFAKWMANLDFPEAVGPAKRIIFFDKLIYFNT |
| Ga0255769_101595681 | 3300022927 | Salt Marsh | ILSALIISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN |
| Ga0255769_104133481 | 3300022927 | Salt Marsh | ILSALIISPFNFFAKYIANFDFPDAVGPANKIIFLDKINLF |
| Ga0255784_102039592 | 3300023108 | Salt Marsh | MISPFNFLAKCIANFDFPDAVGPANKIIFLDKINLS |
| Ga0255751_100260471 | 3300023116 | Salt Marsh | LSALIISPLIFLAIAMASFDFPDAVGPAISMIFLDKIN |
| (restricted) Ga0233439_104270831 | 3300024261 | Seawater | MTSPLIFFANLIANFDFPEAVGPARRIIFFDKTNLF |
| (restricted) Ga0233443_10537331 | 3300024324 | Seawater | LYTCMLSALMISPFNFFAKXIASFDFPDAVGPARRIIFLDKVNLS |
| Ga0209634_12908122 | 3300025138 | Marine | CILSALIISPFIFFANLMANFDFPEAVGPARRIIFLDKTNLF |
| Ga0209044_10745011 | 3300025709 | Marine | ALIISPFNFFAKXIANFDFPDAVGPARRIIFFDKINLS |
| Ga0209632_100955111 | 3300025886 | Pelagic Marine | CILSAFIISPLIFFAIWQARFDFPEAVGPAKRIIFLDKINLF |
| Ga0209632_105294892 | 3300025886 | Pelagic Marine | FIISPLILFAISIASFDFPEAVGPARSMIFLDKLILF |
| Ga0209630_101418911 | 3300025892 | Pelagic Marine | TCMLSALIISPFNFFAKXIANFDFPDAVGPARRIIFLDKINLS |
| Ga0209425_101123312 | 3300025897 | Pelagic Marine | ISPFNFFAKWIANFDFPEAVGPARRIIFLDKVNLS |
| Ga0209425_105161062 | 3300025897 | Pelagic Marine | SALIISPFNFFAKXIANFDFPDAVGPARRIIFLDKINLS |
| Ga0208390_11351531 | 3300026081 | Marine | LTISPFNFFAKRIASFDFPDAVGPAKRIIFFDKLINFDT |
| Ga0208390_11401932 | 3300026081 | Marine | MLSALIISPFNFLAKCIASFDFPDAVGPANKIIFFDKINLF |
| Ga0208878_10877061 | 3300026083 | Marine | ILSAFIISPFIFFAKCIANFDFPDAVGPAKRIIFFGKLF |
| Ga0209710_12713351 | 3300027687 | Marine | ISPLIFFAISIASFDFPDAVGPAISIILLDKSNLF |
| Ga0209711_100848781 | 3300027788 | Marine | LSALIISPLIFLAISIASLDFPEAVGPAMRTILLSKSN |
| Ga0209711_102199032 | 3300027788 | Marine | ILSALIISPLIFLAISIAILDFPEAVGPAIRMIFLDKPN |
| Ga0209091_104305632 | 3300027801 | Marine | NSLYICMLSALIISPLIFFANXMANLDFPEAVGPAKRIIFLDKTNLF |
| Ga0209404_109070072 | 3300027906 | Marine | NSLYICILSALMISPFNFLANCIASLDFPDAVGPAKRIIFLDKLI |
| Ga0256358_10529792 | 3300028267 | Freshwater | MLSALIISPSIFIASLNAISDLPEPVGPAIRIIFLHW |
| Ga0228617_10721382 | 3300028297 | Seawater | MISPFNFFAKXIASFDFPDAVGPARRIIFLDKINLS |
| Ga0228615_10928862 | 3300028418 | Seawater | MLSALMISPFNFLAKCIASFDFPDAVGPANKIIFLDKINLF |
| Ga0308022_12119471 | 3300031142 | Marine | LSALIISPLIFLAISIAIFDFPEAVGPAMRTIFLDKPS |
| Ga0308010_10876712 | 3300031510 | Marine | IISPLIFFANWMANLDFPDAVGPANRIIFLDKINLF |
| Ga0315331_100872663 | 3300031774 | Seawater | ILNSLYICMLSAFIISPFNFLANCIANFDLPDAVGPAKRIIFLDKLI |
| Ga0315316_115107911 | 3300032011 | Seawater | FIISPLIFFAKVIAKLDLPDAVGPAISIIFLDKFN |
| Ga0315316_116477832 | 3300032011 | Seawater | ISPFNFFAKXIANFDFPEAVGPAKRIIFFDKINLF |
| Ga0315330_103686661 | 3300032047 | Seawater | LYTCMLSALMISPFNLFAKXIASFDFPDAVGPAIRIIFLDKINLS |
| Ga0315329_102623112 | 3300032048 | Seawater | SLYICMLSALIISPFNFLANCIANFDFPDAVEPAKRIIFLDKLI |
| Ga0315315_117492821 | 3300032073 | Seawater | LIISPFNFLANFIASLDFPYAVGPAKRIILLDKLI |
| Ga0315315_119006362 | 3300032073 | Seawater | LYTCMLSALMISPLIFFANLIANFDFPEAVGPARRIIFFDKTNLF |
| Ga0310342_1019040971 | 3300032820 | Seawater | SAFIISPLSFFANLIAKLDFPEAVGPAKSTNFLDKINLF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |