Basic Information | |
---|---|
Family ID | F087288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 45 residues |
Representative Sequence | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLRQEARELSTGTRR |
Number of Associated Samples | 56 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.18 % |
% of genes near scaffold ends (potentially truncated) | 18.18 % |
% of genes from short scaffolds (< 2000 bps) | 79.09 % |
Associated GOLD sequencing projects | 50 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.545 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (36.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.273 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF01578 | Cytochrom_C_asm | 37.27 |
PF12158 | DUF3592 | 24.55 |
PF02517 | Rce1-like | 7.27 |
PF03379 | CcmB | 5.45 |
PF02661 | Fic | 2.73 |
PF03544 | TonB_C | 1.82 |
PF00005 | ABC_tran | 1.82 |
PF01964 | ThiC_Rad_SAM | 0.91 |
PF13581 | HATPase_c_2 | 0.91 |
PF03992 | ABM | 0.91 |
PF13424 | TPR_12 | 0.91 |
PF03576 | Peptidase_S58 | 0.91 |
PF00528 | BPD_transp_1 | 0.91 |
PF01933 | CofD | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 7.27 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 7.27 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 5.45 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.82 |
COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.91 |
COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.55 % |
Unclassified | root | N/A | 25.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10003044 | All Organisms → cellular organisms → Bacteria | 12171 | Open in IMG/M |
3300000567|JGI12270J11330_10023772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3723 | Open in IMG/M |
3300000567|JGI12270J11330_10061931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1923 | Open in IMG/M |
3300001356|JGI12269J14319_10102701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1394 | Open in IMG/M |
3300006354|Ga0075021_10066330 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
3300006354|Ga0075021_10761749 | Not Available | 624 | Open in IMG/M |
3300009520|Ga0116214_1109785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
3300009520|Ga0116214_1330396 | Not Available | 588 | Open in IMG/M |
3300009524|Ga0116225_1353662 | Not Available | 654 | Open in IMG/M |
3300009524|Ga0116225_1397960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300009672|Ga0116215_1485039 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009698|Ga0116216_10041187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2860 | Open in IMG/M |
3300009824|Ga0116219_10037848 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
3300010379|Ga0136449_100598203 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
3300010379|Ga0136449_102100198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300010379|Ga0136449_103421851 | Not Available | 607 | Open in IMG/M |
3300012931|Ga0153915_11886388 | Not Available | 699 | Open in IMG/M |
3300014156|Ga0181518_10000892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31832 | Open in IMG/M |
3300017821|Ga0187812_1285044 | Not Available | 526 | Open in IMG/M |
3300017822|Ga0187802_10117040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
3300017823|Ga0187818_10061383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1618 | Open in IMG/M |
3300017823|Ga0187818_10115195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
3300017823|Ga0187818_10132000 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300017823|Ga0187818_10201893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300017823|Ga0187818_10374639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300017928|Ga0187806_1184115 | Not Available | 702 | Open in IMG/M |
3300017932|Ga0187814_10062115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1372 | Open in IMG/M |
3300017932|Ga0187814_10226948 | Not Available | 705 | Open in IMG/M |
3300017933|Ga0187801_10443578 | Not Available | 544 | Open in IMG/M |
3300017934|Ga0187803_10008824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4018 | Open in IMG/M |
3300017934|Ga0187803_10101835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
3300017939|Ga0187775_10009192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2476 | Open in IMG/M |
3300017939|Ga0187775_10135408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
3300017939|Ga0187775_10347680 | Not Available | 598 | Open in IMG/M |
3300017939|Ga0187775_10497050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 520 | Open in IMG/M |
3300017942|Ga0187808_10471841 | Not Available | 579 | Open in IMG/M |
3300017943|Ga0187819_10712475 | Not Available | 565 | Open in IMG/M |
3300017943|Ga0187819_10745783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300017955|Ga0187817_10863244 | Not Available | 578 | Open in IMG/M |
3300017959|Ga0187779_10046056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2537 | Open in IMG/M |
3300017959|Ga0187779_10254099 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300017959|Ga0187779_10528941 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300017961|Ga0187778_10018228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4307 | Open in IMG/M |
3300017961|Ga0187778_10112618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1697 | Open in IMG/M |
3300017961|Ga0187778_10148250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
3300017961|Ga0187778_11249894 | Not Available | 521 | Open in IMG/M |
3300017966|Ga0187776_10105179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1687 | Open in IMG/M |
3300017966|Ga0187776_10394576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300017966|Ga0187776_10788216 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300017970|Ga0187783_10031984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3897 | Open in IMG/M |
3300017970|Ga0187783_11051829 | Not Available | 586 | Open in IMG/M |
3300017972|Ga0187781_10515483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
3300017972|Ga0187781_11236163 | Not Available | 550 | Open in IMG/M |
3300017973|Ga0187780_11144803 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300017975|Ga0187782_10077567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2430 | Open in IMG/M |
3300017975|Ga0187782_10141547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1786 | Open in IMG/M |
3300018001|Ga0187815_10373187 | Not Available | 606 | Open in IMG/M |
3300018006|Ga0187804_10294902 | Not Available | 706 | Open in IMG/M |
3300018006|Ga0187804_10376430 | Not Available | 626 | Open in IMG/M |
3300018012|Ga0187810_10183308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
3300018012|Ga0187810_10227828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300018012|Ga0187810_10460841 | Not Available | 539 | Open in IMG/M |
3300018029|Ga0187787_10488669 | Not Available | 503 | Open in IMG/M |
3300018058|Ga0187766_10601868 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300018058|Ga0187766_10632859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 733 | Open in IMG/M |
3300018060|Ga0187765_10623848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300018062|Ga0187784_10045310 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
3300018062|Ga0187784_10394902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
3300018085|Ga0187772_10147889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
3300018085|Ga0187772_10834923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 667 | Open in IMG/M |
3300018086|Ga0187769_10037944 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
3300018086|Ga0187769_10308850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1182 | Open in IMG/M |
3300018086|Ga0187769_11063476 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300018088|Ga0187771_10055536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3096 | Open in IMG/M |
3300018088|Ga0187771_11090044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300018088|Ga0187771_11620204 | Not Available | 549 | Open in IMG/M |
3300018088|Ga0187771_11626177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 548 | Open in IMG/M |
3300018090|Ga0187770_10040602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3308 | Open in IMG/M |
3300018090|Ga0187770_10125487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1938 | Open in IMG/M |
3300018090|Ga0187770_10907714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300018090|Ga0187770_10990291 | Not Available | 676 | Open in IMG/M |
3300021861|Ga0213853_11196636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300027568|Ga0208042_1032109 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300027570|Ga0208043_1064083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
3300027604|Ga0208324_1111919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300027625|Ga0208044_1119227 | Not Available | 754 | Open in IMG/M |
3300027698|Ga0209446_1187602 | Not Available | 532 | Open in IMG/M |
3300027854|Ga0209517_10063923 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
3300027894|Ga0209068_10021961 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
3300027894|Ga0209068_10633604 | Not Available | 624 | Open in IMG/M |
3300027905|Ga0209415_10380030 | Not Available | 1155 | Open in IMG/M |
3300027905|Ga0209415_10482699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 962 | Open in IMG/M |
3300032160|Ga0311301_10520283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
3300032782|Ga0335082_10981002 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300032783|Ga0335079_10016989 | All Organisms → cellular organisms → Bacteria | 8311 | Open in IMG/M |
3300032783|Ga0335079_10119215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2979 | Open in IMG/M |
3300032783|Ga0335079_10167857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2453 | Open in IMG/M |
3300032783|Ga0335079_10174992 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300032783|Ga0335079_10538828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
3300032783|Ga0335079_10709512 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300032805|Ga0335078_10340129 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300032805|Ga0335078_10344408 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
3300032805|Ga0335078_10751391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
3300032805|Ga0335078_10956274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
3300032805|Ga0335078_11399691 | Not Available | 790 | Open in IMG/M |
3300032829|Ga0335070_10211860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1922 | Open in IMG/M |
3300032892|Ga0335081_10140696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3476 | Open in IMG/M |
3300032892|Ga0335081_10481669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
3300032892|Ga0335081_11423484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300032893|Ga0335069_10430450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1542 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 36.36% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 20.91% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 15.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_1000304412 | 3300000567 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGSKAKKLRQEARELRQ* |
JGI12270J11330_100237726 | 3300000567 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELSTGTRR* |
JGI12270J11330_100619314 | 3300000567 | Peatlands Soil | MIHSVTNLYIAYVVTWVIHIGYLLFLGAKARKLRQEARELSTGTRR* |
JGI12269J14319_101027013 | 3300001356 | Peatlands Soil | MIHSVTNLYIAYXVTWVIHIGYLLFLGAKARKLRQEARELSTGTRR* |
Ga0075021_100663304 | 3300006354 | Watersheds | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLREEARDLGTIK* |
Ga0075021_107617492 | 3300006354 | Watersheds | MIRSITNLYLAYAATWLIHIGYLLFLGAKAKKLREEARDLLPGTRR* |
Ga0116214_11097853 | 3300009520 | Peatlands Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLRQE |
Ga0116214_13303962 | 3300009520 | Peatlands Soil | PGRREFHAMIHSVTNLYIAYVVTWVIHIGYLLFLGAKARKLRQEARELSTGTRR* |
Ga0116225_13536622 | 3300009524 | Peatlands Soil | YIAYAVTWVIHIGYLLFLGAKAKKLRQEARELSTGTRR* |
Ga0116225_13979602 | 3300009524 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELGLQQD |
Ga0116215_14850392 | 3300009672 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKARKLRQEARELSTGTRR* |
Ga0116216_100411872 | 3300009698 | Peatlands Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKARKLRQEARELSTGTRR* |
Ga0116219_100378481 | 3300009824 | Peatlands Soil | TNLYIAYAVTWVIHIGYLLFLGAKARKLRQEARELGLQQDARR* |
Ga0136449_1005982032 | 3300010379 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELKR* |
Ga0136449_1021001982 | 3300010379 | Peatlands Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKARKLRQEARGLSTGTRP* |
Ga0136449_1034218511 | 3300010379 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELGLQQDARR* |
Ga0153915_118863882 | 3300012931 | Freshwater Wetlands | MIRSLTNLYLAYAATWVIHIGYLLFLGGKARKLREEAREFTSSPRR* |
Ga0181518_100008927 | 3300014156 | Bog | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKARKLRQEARELGLQQDARR* |
Ga0187812_12850441 | 3300017821 | Freshwater Sediment | MIHSVTNLYIAYAATWVVHIGYLLFLSAKAKKLREEAR |
Ga0187802_101170402 | 3300017822 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLRQEARELSTGTRR |
Ga0187818_100613832 | 3300017823 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLREEARELGNQAKP |
Ga0187818_101151952 | 3300017823 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKKLREEARELATPQGKR |
Ga0187818_101320002 | 3300017823 | Freshwater Sediment | MIHPVSINLLIAYAATWVIHIGYLLFLGAKAKKLRQEARELGTIK |
Ga0187818_102018932 | 3300017823 | Freshwater Sediment | MIHNVTNLYIAYAATWVIHIGYLLFLGAKAKKLRAEARELASQQAKR |
Ga0187818_103746391 | 3300017823 | Freshwater Sediment | VEGVIRPVSINLLIAYVATWVIHIGYLLFLAAKAKKLREEARELGTIK |
Ga0187806_11841151 | 3300017928 | Freshwater Sediment | MIHNVTNLYIAYAATWVIHIGYLLFLGAKAQKLRAEARELATTQTKR |
Ga0187814_100621152 | 3300017932 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKKLREEARELRR |
Ga0187814_102269482 | 3300017932 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLREEARELSTGMRR |
Ga0187801_104435782 | 3300017933 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLGAKARKLREEARELGTRK |
Ga0187803_100088245 | 3300017934 | Freshwater Sediment | MIHPVSINLLIAYAATWVIHIGYLLFLSAKAKKLREEARELGTIK |
Ga0187803_101018351 | 3300017934 | Freshwater Sediment | GRREFHAMIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELGTIK |
Ga0187775_100091923 | 3300017939 | Tropical Peatland | MIHSVANLYIAYAATWVIHIGYLLFLGAKAKKLREEARELTTQQTER |
Ga0187775_101354082 | 3300017939 | Tropical Peatland | MIRTITNLYLAYAATWVIHIGYLLFLAAKAKKLLQEARELGLLTRDPF |
Ga0187775_103476801 | 3300017939 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKKLREEARELTSQQTER |
Ga0187775_104970501 | 3300017939 | Tropical Peatland | MIHSVTNLYIAYAATWAIHIGYLLFLGAKAKKLREEACDLATGTRT |
Ga0187808_104718412 | 3300017942 | Freshwater Sediment | TNLYIAYAATWVVHIGYLLFLSAKAKRLREEARELATPQTKR |
Ga0187819_107124751 | 3300017943 | Freshwater Sediment | IAYAATWVIHIGYLLFLGAKAKKLREEARELSTGMRR |
Ga0187819_107457832 | 3300017943 | Freshwater Sediment | RELHTMIHSATNLYIAYAATWVIHIGYLLFLGAKAKKLREEARELGTIK |
Ga0187817_108632442 | 3300017955 | Freshwater Sediment | AATWVIHIGYLLFLSAKAKRLREEARELATPQGKR |
Ga0187779_100460564 | 3300017959 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYVLFLGAKAKKLREEARELAVPQAKH |
Ga0187779_102540993 | 3300017959 | Tropical Peatland | MIHNVTNLYIAYAATWVIHLAYILFLGAKAKKLREEARELRLEK |
Ga0187779_105289412 | 3300017959 | Tropical Peatland | MIHSATNLYIAYAVTWVIHLAYILFLGAKAKKLREEARELGLSRDARR |
Ga0187778_100182284 | 3300017961 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIAYLLFLGAKAKKLRGESRELSSDTRR |
Ga0187778_101126184 | 3300017961 | Tropical Peatland | MIYSVTNLYIAYVATWVIHIGYLLFLSAKAKRLREEAREFATPQEKR |
Ga0187778_101482502 | 3300017961 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKRLREEARELETPQPKR |
Ga0187778_112498942 | 3300017961 | Tropical Peatland | MIHGVTNLYIAYAATWVIHIGYVLFLGAKAKKLREEARELATPQAKR |
Ga0187776_101051792 | 3300017966 | Tropical Peatland | MIHSLTNLYIAYAATWVIHIGYLLFLDAKARKLRQEARELATPQQNAKT |
Ga0187776_103945762 | 3300017966 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKKLREEARELT |
Ga0187776_107882162 | 3300017966 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLAAKAKKLREEARELASQK |
Ga0187783_100319842 | 3300017970 | Tropical Peatland | MIHSVTNLYIAYAVTWVIHLAYILFLGAKAKKLRHEARELGLPRDARR |
Ga0187783_110518292 | 3300017970 | Tropical Peatland | YIAYAVTWVIHLAYILFLGAKAKKLREEAGELGLSRDARR |
Ga0187781_105154833 | 3300017972 | Tropical Peatland | MIHSVTNLYIAYAATWVIHLAYILFLGAKARKLREEARELSPGPRR |
Ga0187781_112361631 | 3300017972 | Tropical Peatland | MIHSVTNLYIAYAATWVIHLAYILFLGAKAKKLRHEARELG |
Ga0187780_111448032 | 3300017973 | Tropical Peatland | MIHSGTNLYIAYVATWVIHIGYLLFLSAKAKRLREEAREFATPQEKR |
Ga0187782_100775673 | 3300017975 | Tropical Peatland | MIHSVTNLYIAYAVTWVIHIAYLLFLGAKAKKLREEARELSSGPRR |
Ga0187782_101415473 | 3300017975 | Tropical Peatland | MIHSVTNLYIAYAVTWVIHLAYILLLGAKAKKLRQEARELGLPRDARR |
Ga0187815_103731872 | 3300018001 | Freshwater Sediment | MIHSVTNLYIAYAATWVIHIGYLLFLNAKAKKLRQEARELSTGTRR |
Ga0187804_102949021 | 3300018006 | Freshwater Sediment | NLYIAYAATWVIHIGYLLFLGAKAKKLRAEARELAGPRR |
Ga0187804_103764302 | 3300018006 | Freshwater Sediment | MSHPVSINLLIAYAATWVIHIGYLLFLGAKARKLRQEARELRPQQDARR |
Ga0187810_101833083 | 3300018012 | Freshwater Sediment | MEGVIHPASISLYIAYAATWVIHIGYLLFLGAKAKKLRQEARELGTIK |
Ga0187810_102278281 | 3300018012 | Freshwater Sediment | SVTNLYIAYAATWVVHIGYLLFLSAKAKRLREEARELATPQGKR |
Ga0187810_104608412 | 3300018012 | Freshwater Sediment | MIHSVTNLYIAYAATWVVHIGYLLFLSAKAKKLREEARELAIPQTKR |
Ga0187787_104886691 | 3300018029 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLAAKAKKLREEARELASPGTRR |
Ga0187766_106018682 | 3300018058 | Tropical Peatland | MIHSVTNLYIAFAATWVIHIGYLLFLVAKAKKLREEARELTAKD |
Ga0187766_106328592 | 3300018058 | Tropical Peatland | MIHGVTNLYIAYAATWVIHIGYVLFLGTKAKKLREEARELATPQAKR |
Ga0187765_106238482 | 3300018060 | Tropical Peatland | MIHNVTNLYIAYAATWVIHLAYILFLGAKAKKLREEVRELSSQK |
Ga0187784_100453106 | 3300018062 | Tropical Peatland | MIHSVTNLYIAYAVTWVIHLAYILFLGAKAKKLRQEARELGLPRDARR |
Ga0187784_103949023 | 3300018062 | Tropical Peatland | MIHSVTNLYIAYAATWMIHIGYLLFLGAKAKKLREEARELSSGPRR |
Ga0187772_101478892 | 3300018085 | Tropical Peatland | MIHNVTNLYIAYAVTWVIHLAYILFLGAKAKKLREESRELGIDK |
Ga0187772_108349232 | 3300018085 | Tropical Peatland | MIHSVTNLYIAYAATWVIHLAYILFLGAKAKKLREEARELGLPRDARR |
Ga0187769_100379444 | 3300018086 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKRLREEARELKR |
Ga0187769_103088503 | 3300018086 | Tropical Peatland | MIHSTTNLYIAYAATWLIHLGYVLFLNAKAKKLRAEARELSGPRR |
Ga0187769_110634762 | 3300018086 | Tropical Peatland | MIHNVTNLYIAYAATWVIHLAYILFLGAKAKKLREEARELSSQK |
Ga0187771_100555364 | 3300018088 | Tropical Peatland | MIHSGTNLYIAYVATWVIHIGYLLFLSAKAKRLREEARELKR |
Ga0187771_110900442 | 3300018088 | Tropical Peatland | MIHSVTNLYIAYAATWMIHIGYLVFLGAKAKKLREEARDLGLLRDARR |
Ga0187771_116202041 | 3300018088 | Tropical Peatland | MIHNVTNLYIAYAVTWVIHLAYILFLGAKAKKLRDEARELGLSRDARR |
Ga0187771_116261771 | 3300018088 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLREEAREFGLLRDARR |
Ga0187770_100406025 | 3300018090 | Tropical Peatland | MIHSVTNLYIAYAATWVIHIGYLLFLSSKAKKLRQEARELETGTRR |
Ga0187770_101254872 | 3300018090 | Tropical Peatland | MIHSVTNLYVAYAATWVIHIGYLLFLSAKAKRLREEARELATPQGKR |
Ga0187770_109077143 | 3300018090 | Tropical Peatland | YAATWVIHIAYLLFLGAKAKKLRGESRELSSDTRR |
Ga0187770_109902912 | 3300018090 | Tropical Peatland | MIHNVTNLYIAYAATWVIHLAYILFLGAKAKKLRQEARELGLSRDARR |
Ga0213853_111966362 | 3300021861 | Watersheds | MIHSVTNLYIAYAVTWVIHIGYLLFLSAKARKLREEARELRPQQDARR |
Ga0208042_10321092 | 3300027568 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGSKAKKLRQEARELRQ |
Ga0208043_10640832 | 3300027570 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELSTGTRR |
Ga0208324_11119191 | 3300027604 | Peatlands Soil | MIHSVTNLYIAYVVTWVIHIGYLLFLGAKARKLRQ |
Ga0208044_11192272 | 3300027625 | Peatlands Soil | MIHSVTNLYIAYVVTWVIHIGYLLFLGAKARKLRQEARELSTGTRR |
Ga0209446_11876022 | 3300027698 | Bog Forest Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKARKLRQEARELSTGTRR |
Ga0209517_100639232 | 3300027854 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELGLQQDARR |
Ga0209068_100219615 | 3300027894 | Watersheds | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLREEARDLGTIK |
Ga0209068_106336042 | 3300027894 | Watersheds | MIRSITNLYLAYAATWLIHIGYLLFLGAKAKKLREEARDLLPGTRR |
Ga0209415_103800302 | 3300027905 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKAKKLRQEARELKR |
Ga0209415_104826992 | 3300027905 | Peatlands Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLRQEARELSTGRRR |
Ga0311301_105202833 | 3300032160 | Peatlands Soil | MIHSVTNLYIAYAVTWVIHIGYLLFLGAKARKLRQEARELGLQQDARR |
Ga0335082_109810022 | 3300032782 | Soil | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKKLHEEARELATQQSKR |
Ga0335079_100169895 | 3300032783 | Soil | MIHSVTNLYIAYAATWVIHLGYVLFLGAKAKKLRQEARELSADTRR |
Ga0335079_101192153 | 3300032783 | Soil | MIHSVTNLYIAYAVTWVIHIGYILFLNAKAKKLRAEARELNSQR |
Ga0335079_101678574 | 3300032783 | Soil | MIHNVTNLYIAYAATWVIHIGYLLFLGAKARKLRQEARELTSGARR |
Ga0335079_101749925 | 3300032783 | Soil | MIHNVTNLYVAYAATWVIHLAYILFLGAKAKKLREEARELSSQK |
Ga0335079_105388283 | 3300032783 | Soil | IAYAATWVVHIGYLLFLSAKAKRLREEARELATPQTKR |
Ga0335079_107095122 | 3300032783 | Soil | MIHSVTNLYLAYAATWLIHIGYLLFLGSKAKELRQEARELMSQR |
Ga0335078_103401292 | 3300032805 | Soil | MIRSITNLYIAYAVTWVIHIGYILFLNAKARKLREEARELRSQR |
Ga0335078_103444082 | 3300032805 | Soil | MIHSVTNLYIAYAATWVIHLGYVLLLGAKAKKLRQEARELSADTRR |
Ga0335078_107513912 | 3300032805 | Soil | MIHSVTNLYIAYAATWVIHIGYLLFLGAKAKKLRQEARELTSGARR |
Ga0335078_109562742 | 3300032805 | Soil | MIHNVTNLYIAYAATWVIHIAYLLFLGAKAKKLREEARELSSEPRR |
Ga0335078_113996912 | 3300032805 | Soil | MIHSVTNLYIAYAATWVIHIGYILFLGAKAKKLRAEARELQAQQAAGR |
Ga0335070_102118603 | 3300032829 | Soil | MIRSITNLYIAYAATWVIHIGYLLFLGAKAKKLREEARELGLLTRDPS |
Ga0335081_101406965 | 3300032892 | Soil | MIHSVTNLYVAFAATWVIHIGYLLFLGAKAKKLREEARELASPGVRR |
Ga0335081_104816693 | 3300032892 | Soil | MIHSVTNLYIAYAATWVIHIGYLLFLSAKAKRLREEARDLATPQTKR |
Ga0335081_114234842 | 3300032892 | Soil | MIHGVTNLYIAYAVTWVIHIGYILFLNAKAKKLRAEARELNSQR |
Ga0335069_104304503 | 3300032893 | Soil | MIHSVTNLYIAYAATWVIHIGYLLFLAAKAKKLRQEAHELGLLTRDPS |
⦗Top⦘ |