NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087137

Metagenome / Metatranscriptome Family F087137

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087137
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 46 residues
Representative Sequence LNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Number of Associated Samples 89
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 94.55 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (86.364 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(20.909 % of family members)
Environment Ontology (ENVO) Unclassified
(32.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.364 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.74%    β-sheet: 19.57%    Coil/Unstructured: 58.70%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.73 %
UnclassifiedrootN/A7.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10167181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300001282|B570J14230_10166753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300002835|B570J40625_100919187Not Available755Open in IMG/M
3300005418|Ga0068881_1030331All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300005418|Ga0068881_1496783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300005419|Ga0068883_1549268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage943Open in IMG/M
3300005420|Ga0068879_1687186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300005565|Ga0068885_1067460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1016Open in IMG/M
3300005565|Ga0068885_1861077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1297Open in IMG/M
3300006025|Ga0075474_10230557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300006030|Ga0075470_10088540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300006637|Ga0075461_10010369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3079Open in IMG/M
3300006637|Ga0075461_10022678All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2071Open in IMG/M
3300006637|Ga0075461_10106795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300006734|Ga0098073_1023621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage902Open in IMG/M
3300006802|Ga0070749_10636956Not Available573Open in IMG/M
3300006875|Ga0075473_10312424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300007363|Ga0075458_10243862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300007534|Ga0102690_1722366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage941Open in IMG/M
3300007538|Ga0099851_1084821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1217Open in IMG/M
3300007538|Ga0099851_1125975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage965Open in IMG/M
3300007541|Ga0099848_1319820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300007544|Ga0102861_1054054All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300007960|Ga0099850_1330260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300007960|Ga0099850_1372898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300007973|Ga0105746_1040487All Organisms → Viruses → Predicted Viral1444Open in IMG/M
3300008264|Ga0114353_1240674All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300008266|Ga0114363_1145877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300008266|Ga0114363_1200874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300008450|Ga0114880_1148370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300008450|Ga0114880_1189260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300010300|Ga0129351_1158972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300010354|Ga0129333_10437349All Organisms → Viruses → Predicted Viral1153Open in IMG/M
3300010354|Ga0129333_10840690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300010354|Ga0129333_10909152Not Available744Open in IMG/M
3300010368|Ga0129324_10367686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300010370|Ga0129336_10580262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300011381|Ga0102688_1046776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300012012|Ga0153799_1034314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage965Open in IMG/M
3300012017|Ga0153801_1049945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300012970|Ga0129338_1296478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1851Open in IMG/M
3300013372|Ga0177922_10637428Not Available709Open in IMG/M
3300013372|Ga0177922_11043973Not Available774Open in IMG/M
3300017747|Ga0181352_1002099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7426Open in IMG/M
3300017766|Ga0181343_1162113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300019784|Ga0181359_1183312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300020516|Ga0207935_1014829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1098Open in IMG/M
3300020554|Ga0208599_1047704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300021962|Ga0222713_10729387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300022176|Ga0212031_1006765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1508Open in IMG/M
3300022176|Ga0212031_1051542Not Available692Open in IMG/M
3300022179|Ga0181353_1092377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300022190|Ga0181354_1054507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1330Open in IMG/M
3300022198|Ga0196905_1191127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300022200|Ga0196901_1024833All Organisms → Viruses → Predicted Viral2378Open in IMG/M
3300024355|Ga0255157_1021942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300024481|Ga0256330_1080275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300024484|Ga0256332_1035120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1077Open in IMG/M
3300024490|Ga0255185_1009882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1374Open in IMG/M
3300024503|Ga0255152_1045707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300024506|Ga0255168_1038828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300024550|Ga0255266_1043644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1090Open in IMG/M
3300024557|Ga0255283_1027780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1252Open in IMG/M
3300024563|Ga0255236_1099905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300024570|Ga0255276_1053449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300024573|Ga0256337_1049268All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300024855|Ga0255281_1012836Not Available1668Open in IMG/M
3300024857|Ga0256339_1056413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300024860|Ga0256344_1044489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage990Open in IMG/M
3300024865|Ga0256340_1054360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1005Open in IMG/M
3300024867|Ga0255267_1051911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage956Open in IMG/M
3300025075|Ga0209615_108727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300025630|Ga0208004_1070771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300025630|Ga0208004_1075442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage846Open in IMG/M
3300025759|Ga0208899_1253367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300025815|Ga0208785_1140662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300025889|Ga0208644_1343936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300026455|Ga0255155_1052624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300026569|Ga0255277_1057450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1006Open in IMG/M
3300026571|Ga0255289_1051846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300027131|Ga0255066_1060247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300027785|Ga0209246_10243013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300027798|Ga0209353_10234247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300027808|Ga0209354_10021426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2578Open in IMG/M
3300028530|Ga0255279_1029108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage965Open in IMG/M
3300029930|Ga0119944_1009905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1441Open in IMG/M
3300031758|Ga0315907_10459037All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300031787|Ga0315900_10696095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300031787|Ga0315900_10796535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300031857|Ga0315909_10487311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300031857|Ga0315909_10562447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300031857|Ga0315909_10628041All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300031951|Ga0315904_10041613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5220Open in IMG/M
3300031951|Ga0315904_10719432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300031951|Ga0315904_11154198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300032116|Ga0315903_10850599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300033995|Ga0335003_0456144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300034022|Ga0335005_0255403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300034062|Ga0334995_0424277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300034066|Ga0335019_0469817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300034073|Ga0310130_0123718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300034073|Ga0310130_0131395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300034073|Ga0310130_0170880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300034093|Ga0335012_0305957Not Available805Open in IMG/M
3300034093|Ga0335012_0522806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300034103|Ga0335030_0596098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300034110|Ga0335055_0299443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300034122|Ga0335060_0332526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300034284|Ga0335013_0863931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300034357|Ga0335064_0870314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous20.91%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater19.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.09%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.64%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.73%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water2.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.82%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.91%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.91%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005418Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005419Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005565Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007534Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020516Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024355Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300024481Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024490Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300024506Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300024550Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024563Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024570Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024855Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024860Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024867Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025075Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026455Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8hEnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026571Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300028530Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1016718133300000117MarineLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS*
B570J14230_1016675333300001282FreshwaterKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
B570J40625_10091918723300002835FreshwaterLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0068881_103033143300005418Freshwater LakeVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0068881_149678323300005418Freshwater LakeNIVNKLEASSLAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0068883_154926813300005419Freshwater LakeNKLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0068879_168718613300005420Freshwater LakeKLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0068885_106746013300005565Freshwater LakeLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0068885_186107753300005565Freshwater LakeSSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0075474_1023055713300006025AqueousLINIEDFYLNLVNKLEASSIAYSIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS*
Ga0075470_1008854013300006030AqueousNIVNKLEASNLAYSISTFSPPRVLTGTAGELLAGEVTISILSDWS*
Ga0075461_1001036913300006637AqueousLEASNIAYTLGTFSSPAVLAGNTGDLLTGEVNISVLSDWS*
Ga0075461_1002267863300006637AqueousNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0075461_1010679543300006637AqueousLNIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0098073_102362143300006734MarineEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0070749_1063695613300006802AqueousTAPMFDNQGNMINIEDFYLKIVTKLEASSIAYTIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS*
Ga0075473_1031242433300006875AqueousNIEDYYLAIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0075458_1024386233300007363AqueousNIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGIAGDLLSGEVSISVLSDWS*
Ga0102690_172236643300007534Freshwater LakeSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0099851_108482153300007538AqueousEDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS*
Ga0099851_112597543300007538AqueousYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0099848_131982033300007541AqueousIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0102861_105405443300007544EstuarineLINIEDFYLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS*
Ga0099850_133026023300007960AqueousMFDNQGNLTNIEDFYLKIVQKLEASAIAYSIGNFSAPAVLTATAGDLLSGEVQISVLSDWS*
Ga0099850_137289833300007960AqueousNQGNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0105746_104048713300007973Estuary WaterNIEDFYLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS*
Ga0114353_124067413300008264Freshwater, PlanktonDYYLNIVNKLEASSLAYTIGTFSAPAVLTGTVGDLLSGEVSISILSDWS*
Ga0114363_114587733300008266Freshwater, PlanktonDYYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS*
Ga0114363_120087413300008266Freshwater, PlanktonIEDFYLNVVNKLEASSIAYSIGNFSAPAVLTGTVGDLLSGEVQISVLSDWS*
Ga0114880_114837013300008450Freshwater LakeEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0114880_118926013300008450Freshwater LakeIVNKLEASSIAYTIGTFSAPAVLTGTVGDLLSGEVQISVLSDWS*
Ga0129351_115897213300010300Freshwater To Marine Saline GradientIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0129333_1043734943300010354Freshwater To Marine Saline GradientEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVTISVLSDWS*
Ga0129333_1084069013300010354Freshwater To Marine Saline GradientIVLAPMFDNAGNLINIEDFYLNIVNKLETSSIAYTIGTFSAPAVLTGTVGDLLSGEVNISVLSDWS*
Ga0129333_1090915243300010354Freshwater To Marine Saline GradientASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0129324_1036768633300010368Freshwater To Marine Saline GradientANIEDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS*
Ga0129336_1058026213300010370Freshwater To Marine Saline GradientSIAYSIGNFSAPAVLTGTVGDLLSGEVQISVLSDWS*
Ga0102688_104677613300011381Freshwater LakeVNKLEASSLAYSIGTFTAPAVLQGTAGELLSGEVTISILSDWS*
Ga0153799_103431443300012012FreshwaterNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0153801_104994533300012017FreshwaterLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTTGDLLSGEVSISVLSDWS*
Ga0129338_129647813300012970AqueousKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS*
Ga0177922_1063742813300013372FreshwaterLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS*
Ga0177922_1104397333300013372FreshwaterYYLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS*
Ga0181352_100209913300017747Freshwater LakeNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0181343_116211313300017766Freshwater LakeINIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0181359_118331213300019784Freshwater LakeDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0207935_101482913300020516FreshwaterLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0208599_104770413300020554FreshwaterVNKLEASTIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0222713_1072938713300021962Estuarine WaterLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0212031_100676553300022176AqueousANIEDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS
Ga0212031_105154233300022176AqueousVNKLEASSIAYTIGTFSAPAVLSGAAGDLLTGEVSISVLSDWS
Ga0181353_109237713300022179Freshwater LakeRKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS
Ga0181354_105450713300022190Freshwater LakeGIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0196905_119112713300022198AqueousLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0196901_102483343300022200AqueousMFDNQGNLTNIEDFYLRLVQLLDASSIAYTLGDFSAPAVLTATAGDLLSGEVTISVLSDW
Ga0255157_102194253300024355FreshwaterIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS
Ga0256330_108027513300024481FreshwaterGNLINIEDFYLNIVNKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0256332_103512013300024484FreshwaterEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0255185_100988253300024490FreshwaterSSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0255152_104570713300024503FreshwaterLEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS
Ga0255168_103882843300024506FreshwaterYLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0255266_104364443300024550FreshwaterEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0255283_102778013300024557FreshwaterENFYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0255236_109990513300024563FreshwaterKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0255276_105344943300024570FreshwaterVNKLEASNLAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS
Ga0256337_104926853300024573FreshwaterLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0255281_101283653300024855FreshwaterDNQGTLINIEDYYLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0256339_105641333300024857FreshwaterNLINIEDFYLNIVNKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0256344_104448943300024860FreshwaterSNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0256340_105436013300024865FreshwaterKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0255267_105191113300024867FreshwaterKLEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS
Ga0209615_10872733300025075FreshwaterSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0208004_107077143300025630AqueousDYYLNIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0208004_107544243300025630AqueousLEASNIAYTLGTFSSPAVLAGNTGDLLTGEVNISVLSDWS
Ga0208899_125336733300025759AqueousTNIEDFYLNIVNKLEASSLAYTIGTFSAPAVLTGTVGDLLSGEVSISVLSDWS
Ga0208785_114066213300025815AqueousLINIEDFYLNLVNKLEASSIAYSIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS
Ga0208644_134393613300025889AqueousYLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS
Ga0255155_105262433300026455FreshwaterNQGNLINIENYYLNIVNKLEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS
Ga0255277_105745043300026569FreshwaterLEASNIAYSLGTFAAPAVLSNTAGELLSGEVTISVLSDWS
Ga0255289_105184613300026571FreshwaterNKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS
Ga0255066_106024713300027131FreshwaterLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0209246_1024301313300027785Freshwater LakeYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0209353_1023424713300027798Freshwater LakeDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0209354_1002142613300027808Freshwater LakeLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0255279_102910843300028530FreshwaterLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0119944_100990513300029930AquaticYLNIVNKLEASSLAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0315907_1045903713300031758FreshwaterNIEDFYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGDLLSGEVTISVLSDWS
Ga0315900_1069609533300031787FreshwaterEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0315900_1079653513300031787FreshwaterTNIEDFYLNIVNKLEASSIAYTIGTFSAPAVLTGTVGDLLSGEVQISVLSDWS
Ga0315909_1048731143300031857FreshwaterQGNLINIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0315909_1056244713300031857FreshwaterSNLAYSLGTFTAPAVLQGTAGDLLSGEVTISVLSDWS
Ga0315909_1062804133300031857FreshwaterQGNLINIEDYYLAIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS
Ga0315904_1004161383300031951FreshwaterINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0315904_1071943213300031951FreshwaterINIEDYYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS
Ga0315904_1115419833300031951FreshwaterLNIVNKLEASSIAYTIGTFSAPAVLTGIAGDLLSGEVSISVLSDWS
Ga0315903_1085059933300032116FreshwaterASTLAYTIGTFSAPAVLSGTVGDLLSGEVQISVLSDWS
Ga0335003_0456144_371_5353300033995FreshwaterLINIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335005_0255403_914_10603300034022FreshwaterYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0334995_0424277_2_1573300034062FreshwaterIEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335019_0469817_2_1723300034066FreshwaterGNLINIEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0310130_0123718_2_1483300034073Fracking WaterFYLNIVNKLEASSLAYTIGTFSAPTVLTATAGDLLSGEVTISILSDWS
Ga0310130_0131395_1_1323300034073Fracking WaterVQKLDASTIQYSLGTFSAPAVLSGTAGEMLTGEVTISVLSDWS
Ga0310130_0170880_1_1173300034073Fracking WaterASTLAYSIGTFSSPSVLTGTAGELLTGEVTISILSDWS
Ga0335012_0305957_633_8033300034093FreshwaterGNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335012_0522806_438_5573300034093FreshwaterEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335030_0596098_515_6793300034103FreshwaterLINIEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335055_0299443_556_6843300034110FreshwaterNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335060_0332526_678_8213300034122FreshwaterYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335013_0863931_367_4983300034284FreshwaterVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS
Ga0335064_0870314_2_1753300034357FreshwaterQGNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.