NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087077

Metagenome / Metatranscriptome Family F087077

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087077
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 83 residues
Representative Sequence MRPQSPVPLTLEEHRELGAEMRAMNARLQELCKVVVSVYGPNTQAAFTFLKAAEMVSRLCQDLQAQAAKDLPGYPTDGLYL
Number of Associated Samples 84
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.82 %
% of genes near scaffold ends (potentially truncated) 27.27 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.545 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(52.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(38.182 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.38%    β-sheet: 0.00%    Coil/Unstructured: 48.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.118.27.1: DIL domains from class V myosinsd2f6hx_2f6h0.76955
a.25.1.1: Ferritind1yuza11yuz0.74767
a.118.1.14: MIF4G domain-liked1n52a31n520.73812
f.5.1.0: automated matchesd1yc9a_1yc90.73766
a.25.1.1: Ferritind1lkoa11lko0.73089


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF01401Peptidase_M2 20.00
PF12900Pyridox_ox_2 8.18
PF07593UnbV_ASPIC 6.36
PF02492cobW 4.55
PF13620CarboxypepD_reg 2.73
PF13517FG-GAP_3 2.73
PF01467CTP_transf_like 2.73
PF00155Aminotran_1_2 1.82
PF00160Pro_isomerase 1.82
PF00072Response_reg 0.91
PF13489Methyltransf_23 0.91
PF13801Metal_resist 0.91
PF07811TadE 0.91
PF12796Ank_2 0.91
PF00486Trans_reg_C 0.91
PF07238PilZ 0.91
PF00392GntR 0.91
PF01909NTP_transf_2 0.91
PF00005ABC_tran 0.91
PF01408GFO_IDH_MocA 0.91
PF00753Lactamase_B 0.91
PF12704MacB_PCD 0.91
PF07883Cupin_2 0.91
PF07730HisKA_3 0.91
PF00009GTP_EFTU 0.91
PF02769AIRS_C 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 1.82
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.91
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.91
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.91
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.55 %
UnclassifiedrootN/A5.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100000327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae27884Open in IMG/M
3300006102|Ga0075015_100154065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41197Open in IMG/M
3300006642|Ga0075521_10567197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4558Open in IMG/M
3300009628|Ga0116125_1176918All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300010379|Ga0136449_100011858All Organisms → cellular organisms → Bacteria23836Open in IMG/M
3300010379|Ga0136449_100620323All Organisms → cellular organisms → Bacteria → Acidobacteria1837Open in IMG/M
3300010379|Ga0136449_104269397Not Available529Open in IMG/M
3300014151|Ga0181539_1048302All Organisms → cellular organisms → Bacteria2021Open in IMG/M
3300014155|Ga0181524_10105664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1559Open in IMG/M
3300014158|Ga0181521_10056822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2645Open in IMG/M
3300014158|Ga0181521_10439531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4635Open in IMG/M
3300014160|Ga0181517_10524529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4598Open in IMG/M
3300014162|Ga0181538_10258265Not Available958Open in IMG/M
3300014164|Ga0181532_10549628All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300014167|Ga0181528_10001543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus14280Open in IMG/M
3300014167|Ga0181528_10632223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4595Open in IMG/M
3300014168|Ga0181534_10240177All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300014169|Ga0181531_10191066All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300014200|Ga0181526_10491081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4777Open in IMG/M
3300014489|Ga0182018_10005311All Organisms → cellular organisms → Bacteria10422Open in IMG/M
3300014491|Ga0182014_10268961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus887Open in IMG/M
3300014492|Ga0182013_10711602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus502Open in IMG/M
3300014493|Ga0182016_10139517All Organisms → cellular organisms → Bacteria → Acidobacteria1647Open in IMG/M
3300014501|Ga0182024_10460763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1627Open in IMG/M
3300014501|Ga0182024_11709208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus708Open in IMG/M
3300014501|Ga0182024_11948118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4652Open in IMG/M
3300014638|Ga0181536_10337895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4689Open in IMG/M
3300014655|Ga0181516_10258569All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300014657|Ga0181522_10587374Not Available675Open in IMG/M
3300014838|Ga0182030_10000474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus75502Open in IMG/M
3300014838|Ga0182030_11697926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium512Open in IMG/M
3300016701|Ga0181509_1193654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4522Open in IMG/M
3300017925|Ga0187856_1026671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2824Open in IMG/M
3300017929|Ga0187849_1124136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41067Open in IMG/M
3300017935|Ga0187848_10009165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5913Open in IMG/M
3300017940|Ga0187853_10359416All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300017946|Ga0187879_10039313All Organisms → cellular organisms → Bacteria2827Open in IMG/M
3300017946|Ga0187879_10074286All Organisms → cellular organisms → Bacteria → Acidobacteria1971Open in IMG/M
3300017946|Ga0187879_10311737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium874Open in IMG/M
3300017946|Ga0187879_10637093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium593Open in IMG/M
3300017948|Ga0187847_10890190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4506Open in IMG/M
3300017955|Ga0187817_10238672All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300017988|Ga0181520_10326976Not Available1137Open in IMG/M
3300017988|Ga0181520_10587938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4774Open in IMG/M
3300018016|Ga0187880_1037762All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300018016|Ga0187880_1420414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4557Open in IMG/M
3300018034|Ga0187863_10221822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1051Open in IMG/M
3300018034|Ga0187863_10518292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium668Open in IMG/M
3300018035|Ga0187875_10604093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium578Open in IMG/M
3300018035|Ga0187875_10648596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium555Open in IMG/M
3300018040|Ga0187862_10618971All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300018040|Ga0187862_10691344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium597Open in IMG/M
3300018042|Ga0187871_10056013All Organisms → cellular organisms → Bacteria2355Open in IMG/M
3300018042|Ga0187871_10635190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium593Open in IMG/M
3300018047|Ga0187859_10575497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus633Open in IMG/M
3300018057|Ga0187858_10417464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium831Open in IMG/M
3300019787|Ga0182031_1104801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1591Open in IMG/M
3300019787|Ga0182031_1104802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1035Open in IMG/M
3300019787|Ga0182031_1137581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium659Open in IMG/M
3300021402|Ga0210385_11068776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium620Open in IMG/M
3300021474|Ga0210390_11016123All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300021861|Ga0213853_11206050All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300022824|Ga0224518_1007541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium753Open in IMG/M
3300022881|Ga0224545_1004358All Organisms → cellular organisms → Bacteria → Acidobacteria2384Open in IMG/M
3300023101|Ga0224557_1093257All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300027745|Ga0209908_10054790All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300027825|Ga0209039_10000719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus31982Open in IMG/M
3300027854|Ga0209517_10288521All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300027854|Ga0209517_10340761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4862Open in IMG/M
3300027879|Ga0209169_10517722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium626Open in IMG/M
3300027905|Ga0209415_10757855Not Available684Open in IMG/M
3300029907|Ga0311329_10572442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium753Open in IMG/M
3300029911|Ga0311361_10401140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus1441Open in IMG/M
3300029954|Ga0311331_10366157All Organisms → cellular organisms → Bacteria → Acidobacteria1485Open in IMG/M
3300029999|Ga0311339_11456784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium612Open in IMG/M
3300030225|Ga0302196_10178467All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300030503|Ga0311370_11698616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium648Open in IMG/M
3300030617|Ga0311356_11132185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium724Open in IMG/M
3300031236|Ga0302324_101774116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4786Open in IMG/M
3300031236|Ga0302324_101982565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4731Open in IMG/M
3300031242|Ga0265329_10297761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4545Open in IMG/M
3300031250|Ga0265331_10027889All Organisms → cellular organisms → Bacteria2827Open in IMG/M
3300031344|Ga0265316_10008244All Organisms → cellular organisms → Bacteria9696Open in IMG/M
3300031344|Ga0265316_10462058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4910Open in IMG/M
3300031525|Ga0302326_10165606All Organisms → cellular organisms → Bacteria3770Open in IMG/M
3300031711|Ga0265314_10089107All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300031718|Ga0307474_10129621All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300031902|Ga0302322_101335860All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300032160|Ga0311301_10458033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1917Open in IMG/M
3300032770|Ga0335085_12048993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium579Open in IMG/M
3300032783|Ga0335079_10037951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5531Open in IMG/M
3300032783|Ga0335079_11239119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus748Open in IMG/M
3300032783|Ga0335079_12312706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium510Open in IMG/M
3300032828|Ga0335080_10605218All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300032829|Ga0335070_10706228All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300032892|Ga0335081_10249152All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300032893|Ga0335069_10797660All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032893|Ga0335069_11198157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076832Open in IMG/M
3300032897|Ga0335071_10291315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1586Open in IMG/M
3300032898|Ga0335072_10336037All Organisms → cellular organisms → Bacteria1665Open in IMG/M
3300033134|Ga0335073_10303718All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300033134|Ga0335073_11848675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4561Open in IMG/M
3300033158|Ga0335077_10971897All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300033158|Ga0335077_11868908Not Available562Open in IMG/M
3300033402|Ga0326728_10378658All Organisms → cellular organisms → Bacteria → Acidobacteria1225Open in IMG/M
3300033405|Ga0326727_10323759All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300033818|Ga0334804_012944All Organisms → cellular organisms → Bacteria → Acidobacteria3188Open in IMG/M
3300033822|Ga0334828_067175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium943Open in IMG/M
3300033887|Ga0334790_013447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4077Open in IMG/M
3300033977|Ga0314861_0105155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41435Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland20.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil13.64%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog7.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.36%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.64%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.82%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.91%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.91%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.91%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022824Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T-25EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_100000327193300004152Bog Forest SoilVRPQAPVPLTLEEHRELGRELRAANVRLQELCKVVASIYGPHNQASFTFLKVAENLNRLCQDLQAQAAHDCPGFSVDGFYL*
Ga0075015_10015406513300006102WatershedsMRPRVQNPLTLEEHRELGREVRAACARLHELCNLVVAVYGPNTQAAFTFLKVAEHMDRLCKDLQAQAELDCPGFPIDGFYA*
Ga0075521_1056719723300006642Arctic Peat SoilMRPQTPIPLTMEEHRELGVEMRAMNARMQELCKVVVGVYGPHAQAAFTFQKVADGVQRLCQDLQAQASRDLPGYPTDGFYL*
Ga0116125_117691823300009628PeatlandLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEHISRLCHDLQAQAAKDLPGYPIDGLYL*
Ga0136449_100011858173300010379Peatlands SoilVRPQAPVPLTLEEHRELGRELRDANARLQELCKVVASIYGPHNQASFTFLKVAENLNRLCQDLQAQAAHDCPGFSVDGFYL*
Ga0136449_10062032323300010379Peatlands SoilVRPQAPIPLTLEEHRELGRELRAANARLQELCKVVVGVYGPNNQASFTFLKAADSLNRLCQDLQAQAAKDLPGSSVDGLYL*
Ga0136449_10426939713300010379Peatlands SoilRELGRELRAANARLQALCQVVVDVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDLPGFSVDGFYL*
Ga0181539_104830243300014151BogVRPQAPVPLTLEEHRELGCELRAANARLQELCKVVVGVYGPNNQASFTFLKAAEDLNRLCQDLQAQAAKDLPGFSVDGFYL*
Ga0181524_1010566443300014155BogFGGFGVRPQAPVPLTLEEHRELGRELRDANARLQELCKVVVGVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDLPGFSVDGFYL*
Ga0181521_1005682253300014158BogVRPQAPVPLGLEEHRELGRELRAANARLQALCQVVVDVYGPNNQASFTFLKAAENLNRLCQDLQAQAAQDLPGFSVDGLYL*
Ga0181521_1043953123300014158BogRVRIAILPTNDEFVVEGLGMRPQSPVPLTLEEHRELGAEMRAMNARLQELCKVVVSVYGPNTQAAFTFLKAAEMVSRLCQDLQAQAAKDLPGYPTDGLYL*
Ga0181517_1052452913300014160BogMRPQTPVPLTLEEHRELGSEMRAMNARMQELCKMVVSVYGPNNQAAFTFRKVAEATERLCQDLQSQAARDLPGYPTDGFYL*
Ga0181538_1025826513300014162BogELGAEMRSVNARLQELCKVVVSVYGPNAQAAFTFLKAAEQINRLCQDLQAQAAKDLPGFPIDGLYL*
Ga0181532_1054962823300014164BogLEEHRELGRELRDANARLQELCKVVVGVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDHPGFSVDGFYL*
Ga0181528_1000154393300014167BogLERPRGSVSDGDLTSNDDLEGLGMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEQISRLCHDLQAQAAKDLPGYPIDGMYV*
Ga0181528_1063222313300014167BogLEEHRELGAEMRSVNARLKELCKVVVSVYGPNTNAAFNFVKASEQIDRLCQDLQAQAARDLPGYPTDGLYL*
Ga0181534_1024017723300014168BogMRPHTPVPLTLEEHRELGAEMRAVNARLQELCKMVVSVYGPNAPAAFTFMKAASTVERLCQDLQAQASRDLPGYPVDGFYS*
Ga0181531_1019106613300014169BogLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEHISRLCHDLQAQAAKDLPGYPIDGMYL*
Ga0181526_1049108113300014200BogMRPQTPVPLTLEEHRELGNEMRAMNARMQELYKMVVSVYGPNNQAAFTFRKVAEATDRLCQDLQSQAAQDLPGYSTDGFYL*
Ga0182018_1000531163300014489PalsaVPQRAGSRSYLNDDLEGLDMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCQDLQAQAARDLPGYPIDGLYL*
Ga0182014_1026896123300014491BogMHQQAPAPLSLEEHRELGRELRAANARLQELCKVVVGVYGPNNQASFTFIKAADNLNRLCQDLQAQAAKDLPGFSVDGFYL*
Ga0182013_1071160213300014492BogLEEHREMGRELQAAHARLKELYKVVVDIYGPNNHASFTFLRIVENLDRLCQDLQAQAAIDLPGFSVDGLYR*
Ga0182016_1013951723300014493BogVGFHKFHAVARNRLGGLNHDFYRSYEFAFGGFGMRPQTPVPLTLEEHRALGTEMRAVNARLQDLCKVVVSVYGPNTQAAFTFLKVADNMHRLCQDLQSQAARDLPGFPVDGFYL*
Ga0182024_1046076313300014501PermafrostLEEHRELGRELRAANARLQELCKVVVSVYGPNTQASFTFLKLAENLDRLCHDLQAQARQDLPGFPIDSLYR*
Ga0182024_1170920823300014501PermafrostLEEHRELGVEMRAVNARLQELCKVVVSVYGPNAPAAFTFIRVAGTMERLCQDLQAQANRDLPGYPTDGFYI*
Ga0182024_1194811813300014501PermafrostLAEPVLDVSNRDIISNYELVIEGLGMRPQTPIPLTLEEHRELGAEMRTVNARLQELCKMVVSVYGPNAQAAFTFLKAADQINRLCQDLQAQAARDLPGYPTDGLYL*
Ga0181536_1033789523300014638BogVRPQAPVPLTLEEHRELGCELRAANARLQELCKVVVGVYGPNNQASFTFLKAAEDLNRLWQDLQAQAAKDLPGFSVDGFYL*
Ga0181516_1025856923300014655BogMRPQAPAPLTLEEHRELGSEMRAINARVQELCKMVTSVYGPNNQAAFTFRKVADATQRLCQDLESQAAQDLPGFSTGGFYR*
Ga0181522_1058737423300014657BogLTLEEHRELGHEMRAMNARMQELCKMVVSVYGPNNQAAFTFRKVAEATERLCQDLQSQAAQDLPGYSTDGFYL*
Ga0182030_1000047443300014838BogMGRELQAAHARLKELYKVVVDIYGPNNHASFTFLRIVENLDRLCQDLQAQAAIDLPGFSVDGLYR*
Ga0182030_1169792613300014838BogLDMRPQSLVPLTLEEHQELGAEMRAVNARLQELCKLVVSVYGRQNSAAFTFIKAAEDVSRLCQDLQAQAAKDLPGHPIDGLYL*
Ga0181509_119365413300016701PeatlandMRPQTPVPLTLEEHRELGSEMRAMNARMQELCKMVVSVYGPNNQAAFTFRKVAEATERLCQDLQSQAARDLPGYPTDGFYL
Ga0187856_102667133300017925PeatlandVRPQAPVPLGLEEHRELGRELRAANARLQALCQVVVDVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDLPGFSVDGFYL
Ga0187849_112413613300017929PeatlandVRPQAPVPLTLEEHRELGRELRAANARLQELCKVVVSVYGPNNQASFTFLKAAENLNRLCQDLQAQAAHDLPGVSVDGVYF
Ga0187848_1000916513300017935PeatlandVRPQAPVPLTLEEHRELGCELRAANARLQELCKVVVGVYGPNNQASFTFLKAAEDLNRLCQDLQAQAAKDLPGFSVDGFYL
Ga0187853_1035941613300017940PeatlandVRPQAPVPLTLEEHRELGRELRAANARLQELCKVVVSVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDHPGFSVDGFYL
Ga0187879_1003931333300017946PeatlandMRPQTPAPLTLEEHRELGAEMRSVNARLQELCKVVVSVYGPNAQAAFTFLKAAEQINRLCQDLQAQAAKDLPGFPIDGLYL
Ga0187879_1007428623300017946PeatlandVRPQAPVPLTLEEHRELGRELRDANARLQELCKVVVGVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDHPGFSVDGFYL
Ga0187879_1031173723300017946PeatlandMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHAQAAFTFSKAADQVSRLCQDLQAQAAKDLPGYPIDGIYI
Ga0187879_1063709313300017946PeatlandMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEQISRLCHDLQAQAAKDLPGYPIDGMYI
Ga0187847_1089019013300017948PeatlandMRPQAPVPLTLEEHRELGSEMRAINSRVQELCKMVVSVYGPNNQAAFTFLKVAEATQRLCQDLQSQAVRDLPGYSTDGIYHP
Ga0187817_1023867223300017955Freshwater SedimentLTPPPIPLTFEEHRELGRELRAAAIRVLELRNLVVSVYGPNNQASVRFSAIAEDLERLCSDMQAQAEHDCPGFPVHGFYK
Ga0181520_1032697623300017988BogMRPQTPVPLTLEEHRELGTEMRAVNARLQELCKVVVSVYGPNTQAAFTFLKVADGMHRLCQDLQSQAAKDHPGYPVEGFYL
Ga0181520_1058793823300017988BogMRPQTPVPLTLEEHRELGNEMRAMNARMQELYKMVVSVYGPNNQAAFTFRKVAEATERLCQDLQSQAAQDLPGYSTDGFYL
Ga0187880_103776253300018016PeatlandVRPQARVPLTLEEHRELGRELREANARLQELYKVVVGVYGPHNQASFTFLKVAENLNRLCLDLQAQAAQDLPGYSVDGFYL
Ga0187880_142041423300018016PeatlandVRPQAPVPLTLEEHRELGRELRDANARLQELCKVVVGVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDLPGFSVDGFYL
Ga0187863_1022182223300018034PeatlandMRPQTPVPLTLEEHRELGAEMRALNARLQELCKVVVSVYGPNTQAAFTFLKVAGNMHRLCQDLQSQAAQDLPGFPIDGFYL
Ga0187863_1051829223300018034PeatlandMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTVLKAAEHISRLCHDLQAQAAKDLPGYPIDGMYL
Ga0187875_1060409313300018035PeatlandMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCQDLQAQAARDLPGYPIDGLYL
Ga0187875_1064859623300018035PeatlandTSNDELVLEGLGMRPQTPAPLTLEEHRELGAEMRSVNARLQELCKVVVSVYGPNAQAAFTFLKAAEQINRLCQDLQAQAAKDLPGFPIDGLYL
Ga0187862_1061897113300018040PeatlandFLTVPRPGAAAPQRVGSRSYLNDDLEGLGMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEQISRLCHDLQAQAAKDLPGYSIDGMYI
Ga0187862_1069134423300018040PeatlandLEGLGMRPQTPAPLTLEEHRELGAEMRSVNARLQELCKVVVSVYGPNAQAAFTFLKAAEQINRLCQDLQAQAAKDLPGFPIDGLYL
Ga0187871_1005601323300018042PeatlandMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFLKAAEHISRLCHDLQAQAAKDLPGYPIDGLYL
Ga0187871_1063519013300018042PeatlandVSNRDLTLNYGLAFEGLGMRPQTPIPLTLEEHRELAAEMRAVNARMQALCAMVVSVYGPNTQAAFTFLRAAEHVNRLCQDLQAQAAKDLPGYPIDGLYI
Ga0187859_1057549713300018047PeatlandHRELGRELRDANARLQELCKVVVGVYGPNNQASFTFLKAAENLNRLCQDLQAQAAKDHPGFSVDGFYL
Ga0187858_1041746423300018057PeatlandDELVLEGLGMRPQTPAPLTLEEHRELGAEMRSVNARLQELCKVVVSVYGPNAQAAFTFLKAAEQINRLCQDLQAQAAKDLPGFPIDGLYL
Ga0182031_110480123300019787BogLAYRFLGGPNRDLTLNYELVVEGLDMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQAARDLPGYPIDGFYL
Ga0182031_110480223300019787BogMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQAARDLPGYPID
Ga0182031_113758113300019787BogLRDSAGFHALAYRFLGGPNRDLTLNYELVVEGLDMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQAARDLPGYPIDGFYL
Ga0210385_1106877613300021402SoilMRPKSPVPLTLEEHRELGAEMRSTNARLQELCKLVVSVYGPQTQAAFSFLKMAEQMNRLCQDLQAQAAKDLPDYPVDGLYL
Ga0210390_1101612313300021474SoilMRPHSPVPLTVEEHRELGAEMRSTNARLQELCKLVVSVYGPQTQAAFSFLKMAEQMNRLCQDLQAQAAKDLPDYPVDGLYL
Ga0213853_1120605023300021861WatershedsMRPRVQNPLTLEEHRELGREVRAACARLHELCNLVVAVYGPNTQAAFTFLKVAEHMDRLCKDLQAQAELDCPGFPIDGFYA
Ga0224518_100754123300022824SoilHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQAARDLPGYPIDGFYL
Ga0224545_100435823300022881SoilMRPQTPAPLTLEEHRELGAEMRAVNARLRELCKVVVSVYGPHTQAAFTFLKVADNLHRLCQDLQTQAAKDFPGYPIDGFYV
Ga0224557_109325713300023101SoilVPQRVGSRSYLNDDLEGLDMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCQDLQAQAARDLPGYPIDGLYL
Ga0209908_1005479033300027745Thawing PermafrostALAHECPGEPNRDHKFSYELVFGGLGMRPQTPAPLTLEEHRELGAEMRAVNARLRELCKVVVSVYGPHTQAAFTFLKVADNLHRLCQDLQTQAAKDFPGYPIDGFYV
Ga0209039_10000719173300027825Bog Forest SoilVRPQAPVPLTLEEHRELGRELRAANVRLQELCKVVASIYGPHNQASFTFLKVAENLNRLCQDLQAQAAHDCPGFSVDGFYL
Ga0209517_1028852123300027854Peatlands SoilVRPQAPVPLTLEEHRELGRELRDANARLQELCKVVASIYGPHNQASFTFLKVAENLNRLCQDLQAQAAHDCPGFSVDGFYL
Ga0209517_1034076123300027854Peatlands SoilMRPQTPVPLTLDEHRELGSEMRAVNARLRELCKMVVSVYGPNNQAAFTFSKVADATDRLCQDLQSQAATDLPGYPTGGFYL
Ga0209169_1051772223300027879SoilMRPQTPTPLTLEEHRELGAEMRALNARLQELCKVVVSVYGPNAQAAFTFMKAAEHVKRLCQDLQAQAARDLPGFPT
Ga0209415_1075785513300027905Peatlands SoilHRELGRELRDANARLQELCKVVASIYGPHNQASFTFLKVAENLNRLCQDLQAQAAHDCPGFSVDGFYL
Ga0311329_1057244223300029907BogGSSLASAGFHALAYRFLGGPNRDLTLNYELVVEGLDMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQAARDLPGYPIDGFYL
Ga0311361_1040114013300029911BogMRPHTPVPLTLEEHRELGAEMRAVNARMQVLCRMMVSVYGPNAPAAFTFMKVASNMERLCQDLQAQANRDLPGYPIDGFYF
Ga0311331_1036615723300029954BogMRPQTPVPLTLEEHRELGTEMRAVNARLQELCKVVVSVYGPNTQAAFTFLKVADNMHRLCQDLQSQAARDLPGFPVDGFYL
Ga0311339_1145678413300029999PalsaACQITIYLNDDLEGLDMRPQSLVPLTLEEHQELGAEMRAVNARLQELCKLVVSVYGRQNSAAFTFIKAAEDVSRLCQDLQAQAAKDLPGHPIDGLYL
Ga0302196_1017846713300030225BogMRPQTPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHTQAAFTFQKAADQVHRLCQDLQAQA
Ga0311370_1169861623300030503PalsaMRPHTPVPLTLEEHRELGVEMRAVNARLQELCKVVVSVYGPNAPAAFTFIKLAGSMERLCQDLQAQANRDLPGYPTDGFYI
Ga0311356_1113218513300030617PalsaMRPQSLVPLTLEEHQELGAEMRAVNARLQELCKLVVSVYGRQNSAAFTFIKAAEDVSRLCQDLQAQAAKDLPGHPIDGLYL
Ga0302324_10177411613300031236PalsaGAPDRDLTSNDEFVLEGLGMRPQTPIPLTLEEHRELGAEMRAVNARLQELCKMVVSVYGPHTQAAFTFLKAAEQVKRLCQDLQAQAARDLPGFPTDGFYL
Ga0302324_10198256513300031236PalsaMRPQTPVPLTLEEHREMGAEMRAVNARLKELCKVVVSVYGPNTNAAFNFVKASQQLERLCQDLQAQAARDLPGYPTDGLYL
Ga0265329_1029776123300031242RhizosphereMRPQTPVPLTLEEHRELGAEMRATNARLQELCKVVVSVYGPNNNAAFAFLKVAEQVNRLCQDLQAQAAKDLPGYPTEGLYL
Ga0265331_1002788943300031250RhizosphereMRPQTPTPLTLEEHRELGAEMRAVNARLQELSKMVVSVYGPHTQAAFTFLKAAEQVNRLCHDLQAQAAKDLPGFPTDGLYF
Ga0265316_1000824423300031344RhizosphereMRPQTPVPLTLEEHRELGNEMRAMNARMQELCKMVVSVYGPNNQAAFTFRKVAEATNRLCQDLQSQAAQDLPGYPTDGFYL
Ga0265316_1046205823300031344RhizosphereMRPQSLVPLTLEEHRELGAEMRAANARLQELCKLVVSVYGPHNSAAFTFIKAAEQVSRLCQDLQAQAAKDLPGYPIDGLYL
Ga0302326_1016560643300031525PalsaMRPQTPIPLTLEEHRELGAEMRAVNARLQELCKMVVSVYGPHTQAAFTFLKAAEQVKRLCQDLQAQAARDLPGFPTDGFYL
Ga0265314_1008910713300031711RhizosphereMRPQTPVPLTLEEHRELGAEMRATNARLQELCKVVVSVYGPNNNAAFAFLKVAEQVNRLCQDLQAQAAKDLPGYPTEG
Ga0307474_1012962123300031718Hardwood Forest SoilMESTRPLTLEEHRELGKEVGAVTARLHQLCELVLTVYGPNNQAAFTFQQVTQQLERLCQDLQSQARKDLPGFDVERLYEP
Ga0302322_10133586013300031902FenMRPQTPVPLTLEEHRELGVEIRAVNARMQELCKVVVSVYGPNAQVGFTFLRTAEALSRLCQELQTQATRDLPGYQTDGIYT
Ga0311301_1045803323300032160Peatlands SoilMRPQSPVPLTLEEHRELGAEMRAVNARLQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCHDLQAQAAKDLPGYPIDGIYL
Ga0335085_1204899323300032770SoilLEEHQELGTEMKSINARLRELCKVIVSVYGPNTQAAFTFLKAAEHIDRLCQDLQAQAARDLPGYPVDGMYL
Ga0335079_1003795153300032783SoilMRPQTPIPLTLEEHQELGKELRAVNARLQELCRLVADVYGPQSQAAFTFLKVAEAVDRLCQDLQAQAAADLPGYPVNGLYR
Ga0335079_1123911913300032783SoilMRPQTPIPLTLEEHQELGKELKATNARMQELCKLVVDVYGPQSQAAFTFLKAADAMDRLCQELQSQAAADLPGYAVNGLYR
Ga0335079_1231270623300032783SoilMRPQSPVPLTLEEHRELGAEMRMVKARLQELCKLVVSVYGPNNQAAFTFLKAAEQMERLCQDLQAQAAKDLPGLPIDGMYL
Ga0335080_1060521823300032828SoilVFDSWLRVANRDLTSHDDLIFDGFGVRQPAPGPLTLEEHQELGTEMKSINARLRELCKVIVSVYGPNTQAAFTFLKAAEHIDRLCQDLQAQAARDLPGYPVDGMYL
Ga0335070_1070622823300032829SoilMRPQTPVPLTLEEHRELGRELRATNARLQELCKVVVAIYGPNTQAAFTFRKAAENLERLCQDMQAQAAMDLPGIPVDGLYK
Ga0335081_1024915233300032892SoilCEMRPQTPIPLTLEEHQELGKELRAVNARLQELCRLVADVYGPQSQAAFTFLKVAEAVDRLCQDLQAQAAADLPGYPVNGLYR
Ga0335069_1079766023300032893SoilRISPVPLTLEEHRELGRELVAANAKLQELYKVVEAVYGPNNQATFTFLKVAENLERLLQDLQAQAAADHPGFSVNGLYKS
Ga0335069_1119815713300032893SoilMPGPLTLEEHRELAAEMRSVNARLHELCKVVVGVYGPNTQAAFSFMKASEQVERLCQDLQAQAAKDLPGYPVDGLYS
Ga0335071_1029131513300032897SoilLARISPVPLTLEEHRELGRELVAANAKLQELYKVVEAVYGPNNQATFTFLKVAENLERLLQDLQAQAAADHPGFSVNGLYKS
Ga0335072_1033603723300032898SoilMRRQVTVPLTLEEHRELGAEMRAVNGRLQALCELVVSVYGPNTQAAFSFMKAAEQINRLCQDLQTQADKDCPGFPTDGLYR
Ga0335073_1030371823300033134SoilVSDRDLSLNDDLILESLGIHPRSPVPLTLEEHRELGAELRSINARLQELCKLVVSVYGRNTQAAFTFIKAAEHVDRLCQDLQAQAAKDLPGYPIDGLYV
Ga0335073_1184867513300033134SoilTVSGNLQVPRLGAPSVLTCQIRELTSNDEIGFEGIAMRPQTPLPLTLEEHRELGAEMRAVNARLQELCKVVVGVYGPNTKAAFTFLKAAEQIHRLCQDLQAQAAKDLPGYPIDGLYL
Ga0335077_1097189713300033158SoilMRPQTPIPLTLEEHQELGKELKATNARMQELCKLVVDVYGPQSQAAFTFLKAADAMDRLCQELQSQAAADLPGYAVNGL
Ga0335077_1186890823300033158SoilMRPQTPIPLTLEEHQELGKELRAVNARLQELCRLVADVYGPQSQAAFTFLKVAEAVDRLCQDLQAQAAADLPGHPVNGLYR
Ga0326728_1037865823300033402Peat SoilMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFLKAAEHISRLCHDLQAQAAKDLPGYPIDGMYL
Ga0326727_1032375923300033405Peat SoilMRPQSPVPLTLEEHRELGAEMRAMNARLQELCKVVVSVYGPNTQAAFTFLKAAEMVSRLCQDLQAQAAKDLPGYPTDGLYL
Ga0334804_012944_558_8603300033818SoilVPQRAGSRSYLNDDLEGLDMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCQDLQAQAARDLPGYPIDGLYL
Ga0334828_067175_666_9413300033822SoilYLNDDLEGLDMRPQSPVPLTLEEHRELGAEMRAVNARMQELCKVVVSVYGPHNTAAFTFIKAAEQISRLCQDLQAQAARDLPGYPIDGLYL
Ga0334790_013447_2323_25383300033887SoilLEEHRELGRELQAANARLQELCKVVVSVYGPNNQASFTFLKVAENLNRLCQDLQAQASQDLPGFSVDGFYL
Ga0314861_0105155_483_8063300033977PeatlandVADSPLGVPDRDLTLNDDLVLERLGMRRPQTSVPFTLEEHRELGAELRSMNARMQELCKVVVSVYGPNTKAAFTFLKAAEQMSRLCQDLQAQAAKDLPGYPIDGLYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.