Basic Information | |
---|---|
Family ID | F087000 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 44 residues |
Representative Sequence | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYF |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 19.09 % |
% of genes near scaffold ends (potentially truncated) | 98.18 % |
% of genes from short scaffolds (< 2000 bps) | 96.36 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.455 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.091 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.091 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.33% β-sheet: 0.00% Coil/Unstructured: 91.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF12867 | DinB_2 | 40.00 |
PF01259 | SAICAR_synt | 8.18 |
PF13646 | HEAT_2 | 8.18 |
PF00118 | Cpn60_TCP1 | 0.91 |
PF00072 | Response_reg | 0.91 |
PF00486 | Trans_reg_C | 0.91 |
PF07963 | N_methyl | 0.91 |
PF06315 | AceK_kinase | 0.91 |
PF02954 | HTH_8 | 0.91 |
PF00166 | Cpn10 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 8.18 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG4579 | Isocitrate dehydrogenase kinase/phosphatase | Signal transduction mechanisms [T] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.45 % |
Unclassified | root | N/A | 34.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000156|NODE_c0367640 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1006155 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300000955|JGI1027J12803_105179211 | Not Available | 868 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10062282 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300004081|Ga0063454_101265250 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300004114|Ga0062593_100371446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300004114|Ga0062593_102819764 | Not Available | 555 | Open in IMG/M |
3300004267|Ga0066396_10055647 | Not Available | 646 | Open in IMG/M |
3300004480|Ga0062592_100963001 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300004480|Ga0062592_102541987 | Not Available | 516 | Open in IMG/M |
3300004480|Ga0062592_102643675 | Not Available | 507 | Open in IMG/M |
3300004643|Ga0062591_102699226 | Not Available | 525 | Open in IMG/M |
3300005093|Ga0062594_101542487 | Not Available | 684 | Open in IMG/M |
3300005293|Ga0065715_10052460 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300005353|Ga0070669_100773234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Ornithinimicrobium → Ornithinimicrobium pekingense | 815 | Open in IMG/M |
3300005353|Ga0070669_100799231 | Not Available | 802 | Open in IMG/M |
3300005354|Ga0070675_101665376 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300005444|Ga0070694_101730001 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005455|Ga0070663_102018978 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005459|Ga0068867_101213109 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300005518|Ga0070699_100517797 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300005536|Ga0070697_101961687 | Not Available | 524 | Open in IMG/M |
3300005618|Ga0068864_102605438 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005719|Ga0068861_102536223 | Not Available | 516 | Open in IMG/M |
3300005834|Ga0068851_10654749 | Not Available | 643 | Open in IMG/M |
3300005841|Ga0068863_100490401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
3300005844|Ga0068862_100484894 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300005844|Ga0068862_102684964 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005886|Ga0075286_1055508 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006049|Ga0075417_10317072 | Not Available | 759 | Open in IMG/M |
3300006755|Ga0079222_10691727 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300006806|Ga0079220_10324115 | Not Available | 965 | Open in IMG/M |
3300006845|Ga0075421_102496756 | Not Available | 539 | Open in IMG/M |
3300006904|Ga0075424_100813680 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300006914|Ga0075436_101077578 | Not Available | 604 | Open in IMG/M |
3300006918|Ga0079216_10008943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3328 | Open in IMG/M |
3300006918|Ga0079216_10154294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
3300006918|Ga0079216_10840081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter adhaerens | 682 | Open in IMG/M |
3300009093|Ga0105240_11226482 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300009093|Ga0105240_11921832 | Not Available | 616 | Open in IMG/M |
3300009093|Ga0105240_12366298 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300009101|Ga0105247_10245443 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300009148|Ga0105243_10106247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2340 | Open in IMG/M |
3300009148|Ga0105243_10303313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
3300009148|Ga0105243_12054896 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300009148|Ga0105243_12079062 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300009162|Ga0075423_10254028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1841 | Open in IMG/M |
3300009174|Ga0105241_11705570 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300009176|Ga0105242_13163375 | Not Available | 511 | Open in IMG/M |
3300009545|Ga0105237_11665209 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009789|Ga0126307_11567024 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300010036|Ga0126305_11134314 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300010042|Ga0126314_10725654 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300010043|Ga0126380_11476499 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300010166|Ga0126306_10696898 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300010373|Ga0134128_10324940 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
3300010373|Ga0134128_13125788 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010375|Ga0105239_11516272 | Not Available | 775 | Open in IMG/M |
3300010399|Ga0134127_10560205 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300010400|Ga0134122_11759095 | Not Available | 650 | Open in IMG/M |
3300010403|Ga0134123_10872136 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300011119|Ga0105246_10962418 | Not Available | 770 | Open in IMG/M |
3300011269|Ga0137392_11328935 | Not Available | 578 | Open in IMG/M |
3300012354|Ga0137366_10614982 | Not Available | 778 | Open in IMG/M |
3300012904|Ga0157282_10154884 | Not Available | 702 | Open in IMG/M |
3300012948|Ga0126375_10338560 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300012958|Ga0164299_10654602 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300012989|Ga0164305_11257186 | Not Available | 645 | Open in IMG/M |
3300013105|Ga0157369_11702257 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300013297|Ga0157378_11692375 | Not Available | 679 | Open in IMG/M |
3300013297|Ga0157378_12930188 | Not Available | 529 | Open in IMG/M |
3300013308|Ga0157375_11186291 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300013754|Ga0120183_1024226 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300013765|Ga0120172_1035257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
3300014325|Ga0163163_10387521 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300014884|Ga0180104_1124398 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300014968|Ga0157379_11544385 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300015374|Ga0132255_101917847 | Not Available | 901 | Open in IMG/M |
3300015374|Ga0132255_104720386 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300018052|Ga0184638_1268738 | Not Available | 582 | Open in IMG/M |
3300018074|Ga0184640_10034040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2039 | Open in IMG/M |
3300018476|Ga0190274_12641451 | Not Available | 599 | Open in IMG/M |
3300019377|Ga0190264_10292209 | Not Available | 980 | Open in IMG/M |
3300025900|Ga0207710_10272281 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300025910|Ga0207684_10035309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4245 | Open in IMG/M |
3300025917|Ga0207660_11491805 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300025931|Ga0207644_10392826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
3300025934|Ga0207686_11049123 | Not Available | 663 | Open in IMG/M |
3300025936|Ga0207670_10870327 | Not Available | 753 | Open in IMG/M |
3300025936|Ga0207670_11499082 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300025937|Ga0207669_10475320 | Not Available | 995 | Open in IMG/M |
3300025938|Ga0207704_11350678 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300025941|Ga0207711_11915222 | Not Available | 536 | Open in IMG/M |
3300025944|Ga0207661_11836263 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300025960|Ga0207651_12041315 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300025981|Ga0207640_11330132 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300026035|Ga0207703_11457768 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300026088|Ga0207641_12379093 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026089|Ga0207648_11427752 | Not Available | 650 | Open in IMG/M |
3300026095|Ga0207676_10800364 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300026118|Ga0207675_100216643 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
3300026118|Ga0207675_101578634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
3300026121|Ga0207683_10910547 | Not Available | 817 | Open in IMG/M |
3300026142|Ga0207698_10884172 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300030510|Ga0268243_1085996 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300030606|Ga0299906_11319691 | Not Available | 515 | Open in IMG/M |
3300031716|Ga0310813_10481304 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300031731|Ga0307405_11333158 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300032180|Ga0307471_103614362 | Not Available | 547 | Open in IMG/M |
3300033412|Ga0310810_10461421 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.91% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
NODE_03676401 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MATATDRQKTAKENFSVPESGERKVSLLVVEDDENI |
KanNP_Total_noBrdU_T14TCDRAFT_10061553 | 3300000596 | Soil | MATATDRQKLAKENSTVPDAGERRVSLLVVEDDENISSAISEYF |
JGI1027J12803_1051792113 | 3300000955 | Soil | MATATDRQKTAKENFTVPDAGERKVTLLVVEDDENISTAISECFSR |
JGIcombinedJ43975_100622822 | 3300002899 | Soil | MGTAAERQKFANDNHQVVEQSERKISLLVVEDDENISTAITEYFSRAGY |
Ga0063454_1012652502 | 3300004081 | Soil | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSR |
Ga0062593_1003714461 | 3300004114 | Soil | MGTATDIQKSKDQHHSSDPGERKVSLLVVEDDENISTAISEYFSRAGYDV |
Ga0062593_1028197641 | 3300004114 | Soil | MATATDRQKIAKESLTVTDAGERKVSLLVVEDDENISTAIS |
Ga0066396_100556472 | 3300004267 | Tropical Forest Soil | MATATDRQKIAKENYTVPDAGERKVTLLVVEDDENISTAI |
Ga0062592_1009630012 | 3300004480 | Soil | MATATDRQKTAKENFSVPDSGERKVSLLVVEDDENISTAISEYFS |
Ga0062592_1025419871 | 3300004480 | Soil | MGTATDIQKSKDNHSASDPSERKVSLLVVEDDENISTAISEYFS |
Ga0062592_1026436751 | 3300004480 | Soil | MGTATDIQKSKDNHSAADPSERKVSLLVVEDDENISTAISEYFS |
Ga0062591_1026992261 | 3300004643 | Soil | MGTATDIQKSKDQHHSSDPGERKVSLLVVEDDENISTAISEYF |
Ga0062594_1015424872 | 3300005093 | Soil | MTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAGYNVK |
Ga0065715_100524602 | 3300005293 | Miscanthus Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFS |
Ga0070669_1007732341 | 3300005353 | Switchgrass Rhizosphere | MATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENISTAISEYFSRAGYNVK |
Ga0070669_1007992311 | 3300005353 | Switchgrass Rhizosphere | MTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEY |
Ga0070675_1016653761 | 3300005354 | Miscanthus Rhizosphere | MATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTAISEYFS |
Ga0070694_1017300012 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGYYVRT |
Ga0070663_1020189782 | 3300005455 | Corn Rhizosphere | MATATDRQKTAKEGFPVPDSGERKVSLLVVEDDENISTAISEYFS |
Ga0068867_1012131091 | 3300005459 | Miscanthus Rhizosphere | MGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGYYVRTVEDGL |
Ga0070699_1005177973 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATDRQKIAKENFPVPDSGERKVSLLVVEDDENISTAISEYFSRAG |
Ga0070697_1019616871 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIVTDKQIKANKESYSVLDSGERKISLLVVEDDENISTAI |
Ga0068864_1026054382 | 3300005618 | Switchgrass Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISE |
Ga0068861_1025362231 | 3300005719 | Switchgrass Rhizosphere | MGTAAERQKFANDNHQAVEQGERKISLLVVEDDENIST |
Ga0068851_106547491 | 3300005834 | Corn Rhizosphere | MATATDRQKIAKESLTVTDAGERKVSLLVVEDDENIS |
Ga0068863_1004904013 | 3300005841 | Switchgrass Rhizosphere | MTNTATDRQKISKDNGHPAEPTERKISLLVVEDDENI |
Ga0068862_1004848941 | 3300005844 | Switchgrass Rhizosphere | MATATDRQKTAKENFPVPDSGERKVSLLVVEDDENISTAISEYFSRAG |
Ga0068862_1026849641 | 3300005844 | Switchgrass Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAI |
Ga0075286_10555082 | 3300005886 | Rice Paddy Soil | MATATDRQKTAKENFPVPDSGERKVSLLVVEDDENIS |
Ga0075417_103170721 | 3300006049 | Populus Rhizosphere | MATATDRQKLAKENSTVPDAGERKVSLLVVEDDENISSAISEYFS |
Ga0079222_106917272 | 3300006755 | Agricultural Soil | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSRAG |
Ga0079220_103241151 | 3300006806 | Agricultural Soil | MATATDRQKTAKENFTVPDAGERKVTLLVVEDDENISTAISEY |
Ga0075421_1024967562 | 3300006845 | Populus Rhizosphere | MATATDRQKLAKENSTVPDAGERRVSLLVVEDDENISSAI |
Ga0075424_1008136803 | 3300006904 | Populus Rhizosphere | MATATDRQKTAKENFAVPDNGERKVSLLVVEDDENISTAISE |
Ga0075436_1010775781 | 3300006914 | Populus Rhizosphere | MAIATDRQKSPKDNFSLPDAGERRVSLLVVEDDENIST |
Ga0079216_100089431 | 3300006918 | Agricultural Soil | MTTIATDRQKTSNNNPPAESGERKISLLVVEDDENISSAISEYFSRAGYDVKTV |
Ga0079216_101542941 | 3300006918 | Agricultural Soil | MATATDRQKIAKENFPVPDSGERKVSLLVVEDDENISTAISEYF |
Ga0079216_108400811 | 3300006918 | Agricultural Soil | MTTIATDRQKTSNNNPPAESGERKISLLVVEDDENISSAISEYFSRAGYDVKTVE |
Ga0105240_112264822 | 3300009093 | Corn Rhizosphere | MATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTA |
Ga0105240_119218322 | 3300009093 | Corn Rhizosphere | MTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAGYNV |
Ga0105240_123662982 | 3300009093 | Corn Rhizosphere | MATATDRQKTAKEGFPVPDSGERKVSLLVVEDDENISTAISEYFSR |
Ga0105247_102454431 | 3300009101 | Switchgrass Rhizosphere | MMATATDRQKTAKENFAPDSGERKVSLLVVEDDENIST |
Ga0105243_101062471 | 3300009148 | Miscanthus Rhizosphere | MATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTA |
Ga0105243_103033132 | 3300009148 | Miscanthus Rhizosphere | MTNTATDRQKISKDNGHPAEPTERKISLLVVEDDENISSAI |
Ga0105243_120548961 | 3300009148 | Miscanthus Rhizosphere | MTTATDRQKTGKENFQVPDSGERKVSLLVVEDDENISTAISEYFSRAGY |
Ga0105243_120790621 | 3300009148 | Miscanthus Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEY |
Ga0075423_102540282 | 3300009162 | Populus Rhizosphere | MATATDRQKVLRDNLSIPDAGERKVSLLVVEDDENISTAISEYFSR |
Ga0105241_117055702 | 3300009174 | Corn Rhizosphere | MATATDRQKLAKENFPVPDSGERKVSLLVVEDDENISTAISE |
Ga0105242_131633751 | 3300009176 | Miscanthus Rhizosphere | MTNTAADRQKTSKDNSQPAEALERRVSLLVVEDDENISSAISEYFSR |
Ga0105237_116652092 | 3300009545 | Corn Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAIS |
Ga0126307_115670242 | 3300009789 | Serpentine Soil | MAMATATDRQKTAKENFAVPDSGERKVSLLVVEDD |
Ga0126305_111343142 | 3300010036 | Serpentine Soil | MATATDRQKTVKENFAMPESGERKVSLLVVEDDENISTAISEYFS |
Ga0126314_107256541 | 3300010042 | Serpentine Soil | MATATDRQKTGKENFGVPDSGERKVSLLVVEDDENISTAISEYF |
Ga0126380_114764991 | 3300010043 | Tropical Forest Soil | MATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAISEYF |
Ga0126306_106968981 | 3300010166 | Serpentine Soil | MATATDRQKTAKENFAMPESGERKVSLLVVEDDENISTAISEYFSRAG |
Ga0134128_103249403 | 3300010373 | Terrestrial Soil | MATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISEYF* |
Ga0134128_131257881 | 3300010373 | Terrestrial Soil | MATATDRQKTAKDGLPVPETGERKVSLLVVEDDENISTAIS |
Ga0105239_115162722 | 3300010375 | Corn Rhizosphere | MATATDRQKITKDNFPVPDSGERKVSLLVVEDDENIS |
Ga0134127_105602053 | 3300010399 | Terrestrial Soil | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDEN |
Ga0134122_117590952 | 3300010400 | Terrestrial Soil | MTNTATDRQKTSRDNSQPTEPLEGKVSLLVVEDDENISSAISEYFSRAGYNVKTV |
Ga0134123_108721361 | 3300010403 | Terrestrial Soil | MATATDRQKTAKENFSVPDSGERKVSLLVVEDDENISTAISE |
Ga0105246_109624182 | 3300011119 | Miscanthus Rhizosphere | MTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAG |
Ga0137392_113289352 | 3300011269 | Vadose Zone Soil | MTTTATDRQKNPRDTSHPTEPGERKISLLVVEDDENISSAISEYFS |
Ga0137366_106149821 | 3300012354 | Vadose Zone Soil | MPIITDKQIKANKESYSVLDSGERKISLLVVEDDENISTAISEYFSRAGYT |
Ga0157282_101548841 | 3300012904 | Soil | MTNTAADRQKTSRDNSRPAEPLESRVSLLVVEDDENISSAISEYFS |
Ga0126375_103385601 | 3300012948 | Tropical Forest Soil | MATATDRQKIAKENSTVPDAGERRISLLVVEDDENISSAIHEYLSRAG |
Ga0164299_106546022 | 3300012958 | Soil | MATATDRQKLAKENFPVPDSGERKVSLLVVEDDENISTAI |
Ga0164305_112571861 | 3300012989 | Soil | MTTTATDRQKNPRENSHPTEPGERKVSLLVVEDDENI |
Ga0157369_117022572 | 3300013105 | Corn Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTA |
Ga0157378_116923751 | 3300013297 | Miscanthus Rhizosphere | MTTTATDRQKNPIENSHPTEPAERKVSLLVVEDDENISSAISEYFSRA |
Ga0157378_129301882 | 3300013297 | Miscanthus Rhizosphere | MGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGY |
Ga0157375_111862911 | 3300013308 | Miscanthus Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSRA |
Ga0120183_10242261 | 3300013754 | Terrestrial | MATATDRQKSAKENFAVPDSGERKISLLVVEDDENISRAI |
Ga0120172_10352571 | 3300013765 | Permafrost | MTTTATDRQKTSKDNGHPTEPGERKISLLVVEDDENISSAISEYFSRAGYNVR |
Ga0163163_103875211 | 3300014325 | Switchgrass Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENIST |
Ga0180104_11243982 | 3300014884 | Soil | LMTNTAADRQKTSRDNSQPAEALERRVSLLVVEDDENISSAISEYFSRAGYNV* |
Ga0157379_115443851 | 3300014968 | Switchgrass Rhizosphere | MATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENIS |
Ga0132255_1019178472 | 3300015374 | Arabidopsis Rhizosphere | MATATDRQKIAKENFTIPDAGERKVTLLVVEDDEN |
Ga0132255_1047203862 | 3300015374 | Arabidopsis Rhizosphere | MATATDRQKIAKDNFPVPDSGERKVSLLVVEDDENIST |
Ga0184638_12687381 | 3300018052 | Groundwater Sediment | MTTTATDKQKITKDITQSAEPSERKISLLVVEDDEN |
Ga0184640_100340403 | 3300018074 | Groundwater Sediment | MTTTATDKQKISKDNNQPAEPTERKISLLVVEDDENISSAISEYFSRAG |
Ga0190274_126414511 | 3300018476 | Soil | MTNTATDRQKTSKDNGHPAEPLERKVSLLVVEDDENISSAISEYFSRA |
Ga0190264_102922091 | 3300019377 | Soil | MTTTATDRQKTSRDNNQPAESGERKISLLVVEDDENISSAIS |
Ga0207710_102722811 | 3300025900 | Switchgrass Rhizosphere | MMATATDRQKTAKENFAPDSGERKVSLLVVEDDENISTAISEYFSR |
Ga0207684_100353091 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTTATDRQKTIKDNYPIADPSEHKISLLIVEDDE |
Ga0207660_114918052 | 3300025917 | Corn Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENI |
Ga0207644_103928261 | 3300025931 | Switchgrass Rhizosphere | MATATDRQKTAKENFSVPESGERKVSLLVVEDDENISTAISEY |
Ga0207686_110491231 | 3300025934 | Miscanthus Rhizosphere | MTNTAADRQKTSKDNSQPAEALERRVSLLVVEDDENISSAISEYFSRAGY |
Ga0207670_108703272 | 3300025936 | Switchgrass Rhizosphere | MATATDRQKIAKENLTVTDAGERKVSLLVVEDDENISTAISEYF |
Ga0207670_114990822 | 3300025936 | Switchgrass Rhizosphere | MATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAISEYFSRAEYHVRT |
Ga0207669_104753201 | 3300025937 | Miscanthus Rhizosphere | MATATDRQKIVKENFTVPEVGERKVTLLVVEADENIST |
Ga0207704_113506781 | 3300025938 | Miscanthus Rhizosphere | MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYF |
Ga0207711_119152221 | 3300025941 | Switchgrass Rhizosphere | MATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENISTAISEYFSRAGYNVKTVE |
Ga0207661_118362631 | 3300025944 | Corn Rhizosphere | MATATDRQKIAKDTFPVPDSGERKVSLLVVEDDENISTA |
Ga0207651_120413152 | 3300025960 | Switchgrass Rhizosphere | MMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISE |
Ga0207640_113301321 | 3300025981 | Corn Rhizosphere | MATATDRQKLAKENFPVPDSGERKVSLLVVEDDEN |
Ga0207703_114577681 | 3300026035 | Switchgrass Rhizosphere | MTTATDRQKTAKENFAVPESGERKVSLLVVEDDENISTAISEYFSRA |
Ga0207641_123790932 | 3300026088 | Switchgrass Rhizosphere | MTTATDRQKTAKENFAVPESGERKVSLLVVEDDEN |
Ga0207648_114277522 | 3300026089 | Miscanthus Rhizosphere | MTITAADKQKTSRDNNQPAEPGERKVSLLVVEDDENISSAISEYFSRAGY |
Ga0207676_108003641 | 3300026095 | Switchgrass Rhizosphere | MATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISE |
Ga0207675_1002166433 | 3300026118 | Switchgrass Rhizosphere | MATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTAISEYFSRA |
Ga0207675_1015786342 | 3300026118 | Switchgrass Rhizosphere | MTTTATDRQKTSKDSHPTEPSERKISLLVVEDDENISSAISEYFSRAGYN |
Ga0207683_109105471 | 3300026121 | Miscanthus Rhizosphere | MTNTAADRQKTSGNSQPVEPIERKISLLVVEDDENISSAISEYFSRAGYNVKTV |
Ga0207698_108841723 | 3300026142 | Corn Rhizosphere | MTNTAADRQKTAKDNGHPAEPIERKISLLVVEDDENISSAI |
Ga0268243_10859961 | 3300030510 | Soil | MMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISEYFS |
Ga0299906_113196911 | 3300030606 | Soil | MITATTDRQKTAKENQLFEAGERKVALLVVEDDENISTAISEY |
Ga0310813_104813041 | 3300031716 | Soil | MATATDRQKTAKDGLPVAETGERKVSLLVVEDDENI |
Ga0307405_113331582 | 3300031731 | Rhizosphere | MATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAI |
Ga0307471_1036143621 | 3300032180 | Hardwood Forest Soil | MATATDRQKTAKENFTVPDAGERKVALLVVEDDENISTAI |
Ga0310810_104614211 | 3300033412 | Soil | MATATDRHKTAKENFAAPESGERKVSLLVVEDDENISTAISEYFSRAGYN |
⦗Top⦘ |