NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087000

Metagenome Family F087000

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087000
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 44 residues
Representative Sequence MATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYF
Number of Associated Samples 93
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.09 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 96.36 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.455 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.091 % of family members)
Environment Ontology (ENVO) Unclassified
(49.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.33%    β-sheet: 0.00%    Coil/Unstructured: 91.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF12867DinB_2 40.00
PF01259SAICAR_synt 8.18
PF13646HEAT_2 8.18
PF00118Cpn60_TCP1 0.91
PF00072Response_reg 0.91
PF00486Trans_reg_C 0.91
PF07963N_methyl 0.91
PF06315AceK_kinase 0.91
PF02954HTH_8 0.91
PF00166Cpn10 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0152Phosphoribosylaminoimidazole-succinocarboxamide synthaseNucleotide transport and metabolism [F] 8.18
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.91
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.91
COG4579Isocitrate dehydrogenase kinase/phosphataseSignal transduction mechanisms [T] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.45 %
UnclassifiedrootN/A34.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0367640All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1006155All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300000955|JGI1027J12803_105179211Not Available868Open in IMG/M
3300002899|JGIcombinedJ43975_10062282All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300004081|Ga0063454_101265250All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300004114|Ga0062593_100371446All Organisms → cellular organisms → Bacteria → Acidobacteria1262Open in IMG/M
3300004114|Ga0062593_102819764Not Available555Open in IMG/M
3300004267|Ga0066396_10055647Not Available646Open in IMG/M
3300004480|Ga0062592_100963001All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300004480|Ga0062592_102541987Not Available516Open in IMG/M
3300004480|Ga0062592_102643675Not Available507Open in IMG/M
3300004643|Ga0062591_102699226Not Available525Open in IMG/M
3300005093|Ga0062594_101542487Not Available684Open in IMG/M
3300005293|Ga0065715_10052460All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005353|Ga0070669_100773234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Ornithinimicrobium → Ornithinimicrobium pekingense815Open in IMG/M
3300005353|Ga0070669_100799231Not Available802Open in IMG/M
3300005354|Ga0070675_101665376All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005444|Ga0070694_101730001All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005455|Ga0070663_102018978All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005459|Ga0068867_101213109All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005518|Ga0070699_100517797All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300005536|Ga0070697_101961687Not Available524Open in IMG/M
3300005618|Ga0068864_102605438All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005719|Ga0068861_102536223Not Available516Open in IMG/M
3300005834|Ga0068851_10654749Not Available643Open in IMG/M
3300005841|Ga0068863_100490401All Organisms → cellular organisms → Bacteria → Acidobacteria1209Open in IMG/M
3300005844|Ga0068862_100484894All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300005844|Ga0068862_102684964All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005886|Ga0075286_1055508All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006049|Ga0075417_10317072Not Available759Open in IMG/M
3300006755|Ga0079222_10691727All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300006806|Ga0079220_10324115Not Available965Open in IMG/M
3300006845|Ga0075421_102496756Not Available539Open in IMG/M
3300006904|Ga0075424_100813680All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300006914|Ga0075436_101077578Not Available604Open in IMG/M
3300006918|Ga0079216_10008943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3328Open in IMG/M
3300006918|Ga0079216_10154294All Organisms → cellular organisms → Bacteria → Acidobacteria1201Open in IMG/M
3300006918|Ga0079216_10840081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter adhaerens682Open in IMG/M
3300009093|Ga0105240_11226482All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300009093|Ga0105240_11921832Not Available616Open in IMG/M
3300009093|Ga0105240_12366298All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009101|Ga0105247_10245443All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300009148|Ga0105243_10106247All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2340Open in IMG/M
3300009148|Ga0105243_10303313All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300009148|Ga0105243_12054896All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300009148|Ga0105243_12079062All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009162|Ga0075423_10254028All Organisms → cellular organisms → Bacteria → Acidobacteria1841Open in IMG/M
3300009174|Ga0105241_11705570All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300009176|Ga0105242_13163375Not Available511Open in IMG/M
3300009545|Ga0105237_11665209All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300009789|Ga0126307_11567024All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010036|Ga0126305_11134314All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010042|Ga0126314_10725654All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300010043|Ga0126380_11476499All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300010166|Ga0126306_10696898All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300010373|Ga0134128_10324940All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300010373|Ga0134128_13125788All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010375|Ga0105239_11516272Not Available775Open in IMG/M
3300010399|Ga0134127_10560205All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300010400|Ga0134122_11759095Not Available650Open in IMG/M
3300010403|Ga0134123_10872136All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300011119|Ga0105246_10962418Not Available770Open in IMG/M
3300011269|Ga0137392_11328935Not Available578Open in IMG/M
3300012354|Ga0137366_10614982Not Available778Open in IMG/M
3300012904|Ga0157282_10154884Not Available702Open in IMG/M
3300012948|Ga0126375_10338560All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300012958|Ga0164299_10654602All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300012989|Ga0164305_11257186Not Available645Open in IMG/M
3300013105|Ga0157369_11702257All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300013297|Ga0157378_11692375Not Available679Open in IMG/M
3300013297|Ga0157378_12930188Not Available529Open in IMG/M
3300013308|Ga0157375_11186291All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300013754|Ga0120183_1024226All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300013765|Ga0120172_1035257All Organisms → cellular organisms → Bacteria → Acidobacteria1356Open in IMG/M
3300014325|Ga0163163_10387521All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300014884|Ga0180104_1124398All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300014968|Ga0157379_11544385All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300015374|Ga0132255_101917847Not Available901Open in IMG/M
3300015374|Ga0132255_104720386All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300018052|Ga0184638_1268738Not Available582Open in IMG/M
3300018074|Ga0184640_10034040All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2039Open in IMG/M
3300018476|Ga0190274_12641451Not Available599Open in IMG/M
3300019377|Ga0190264_10292209Not Available980Open in IMG/M
3300025900|Ga0207710_10272281All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300025910|Ga0207684_10035309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4245Open in IMG/M
3300025917|Ga0207660_11491805All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300025931|Ga0207644_10392826All Organisms → cellular organisms → Bacteria → Proteobacteria1133Open in IMG/M
3300025934|Ga0207686_11049123Not Available663Open in IMG/M
3300025936|Ga0207670_10870327Not Available753Open in IMG/M
3300025936|Ga0207670_11499082All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300025937|Ga0207669_10475320Not Available995Open in IMG/M
3300025938|Ga0207704_11350678All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025941|Ga0207711_11915222Not Available536Open in IMG/M
3300025944|Ga0207661_11836263All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025960|Ga0207651_12041315All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025981|Ga0207640_11330132All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300026035|Ga0207703_11457768All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300026088|Ga0207641_12379093All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300026089|Ga0207648_11427752Not Available650Open in IMG/M
3300026095|Ga0207676_10800364All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300026118|Ga0207675_100216643All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300026118|Ga0207675_101578634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium677Open in IMG/M
3300026121|Ga0207683_10910547Not Available817Open in IMG/M
3300026142|Ga0207698_10884172All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300030510|Ga0268243_1085996All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300030606|Ga0299906_11319691Not Available515Open in IMG/M
3300031716|Ga0310813_10481304All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300031731|Ga0307405_11333158All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032180|Ga0307471_103614362Not Available547Open in IMG/M
3300033412|Ga0310810_10461421All Organisms → cellular organisms → Bacteria1282Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.55%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.82%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.91%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_036764013300000156Sugar Cane Bagasse Incubating BioreactorMATATDRQKTAKENFSVPESGERKVSLLVVEDDENI
KanNP_Total_noBrdU_T14TCDRAFT_100615533300000596SoilMATATDRQKLAKENSTVPDAGERRVSLLVVEDDENISSAISEYF
JGI1027J12803_10517921133300000955SoilMATATDRQKTAKENFTVPDAGERKVTLLVVEDDENISTAISECFSR
JGIcombinedJ43975_1006228223300002899SoilMGTAAERQKFANDNHQVVEQSERKISLLVVEDDENISTAITEYFSRAGY
Ga0063454_10126525023300004081SoilMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSR
Ga0062593_10037144613300004114SoilMGTATDIQKSKDQHHSSDPGERKVSLLVVEDDENISTAISEYFSRAGYDV
Ga0062593_10281976413300004114SoilMATATDRQKIAKESLTVTDAGERKVSLLVVEDDENISTAIS
Ga0066396_1005564723300004267Tropical Forest SoilMATATDRQKIAKENYTVPDAGERKVTLLVVEDDENISTAI
Ga0062592_10096300123300004480SoilMATATDRQKTAKENFSVPDSGERKVSLLVVEDDENISTAISEYFS
Ga0062592_10254198713300004480SoilMGTATDIQKSKDNHSASDPSERKVSLLVVEDDENISTAISEYFS
Ga0062592_10264367513300004480SoilMGTATDIQKSKDNHSAADPSERKVSLLVVEDDENISTAISEYFS
Ga0062591_10269922613300004643SoilMGTATDIQKSKDQHHSSDPGERKVSLLVVEDDENISTAISEYF
Ga0062594_10154248723300005093SoilMTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAGYNVK
Ga0065715_1005246023300005293Miscanthus RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFS
Ga0070669_10077323413300005353Switchgrass RhizosphereMATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENISTAISEYFSRAGYNVK
Ga0070669_10079923113300005353Switchgrass RhizosphereMTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEY
Ga0070675_10166537613300005354Miscanthus RhizosphereMATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTAISEYFS
Ga0070694_10173000123300005444Corn, Switchgrass And Miscanthus RhizosphereMGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGYYVRT
Ga0070663_10201897823300005455Corn RhizosphereMATATDRQKTAKEGFPVPDSGERKVSLLVVEDDENISTAISEYFS
Ga0068867_10121310913300005459Miscanthus RhizosphereMGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGYYVRTVEDGL
Ga0070699_10051779733300005518Corn, Switchgrass And Miscanthus RhizosphereMATATDRQKIAKENFPVPDSGERKVSLLVVEDDENISTAISEYFSRAG
Ga0070697_10196168713300005536Corn, Switchgrass And Miscanthus RhizosphereMPIVTDKQIKANKESYSVLDSGERKISLLVVEDDENISTAI
Ga0068864_10260543823300005618Switchgrass RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISE
Ga0068861_10253622313300005719Switchgrass RhizosphereMGTAAERQKFANDNHQAVEQGERKISLLVVEDDENIST
Ga0068851_1065474913300005834Corn RhizosphereMATATDRQKIAKESLTVTDAGERKVSLLVVEDDENIS
Ga0068863_10049040133300005841Switchgrass RhizosphereMTNTATDRQKISKDNGHPAEPTERKISLLVVEDDENI
Ga0068862_10048489413300005844Switchgrass RhizosphereMATATDRQKTAKENFPVPDSGERKVSLLVVEDDENISTAISEYFSRAG
Ga0068862_10268496413300005844Switchgrass RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAI
Ga0075286_105550823300005886Rice Paddy SoilMATATDRQKTAKENFPVPDSGERKVSLLVVEDDENIS
Ga0075417_1031707213300006049Populus RhizosphereMATATDRQKLAKENSTVPDAGERKVSLLVVEDDENISSAISEYFS
Ga0079222_1069172723300006755Agricultural SoilMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSRAG
Ga0079220_1032411513300006806Agricultural SoilMATATDRQKTAKENFTVPDAGERKVTLLVVEDDENISTAISEY
Ga0075421_10249675623300006845Populus RhizosphereMATATDRQKLAKENSTVPDAGERRVSLLVVEDDENISSAI
Ga0075424_10081368033300006904Populus RhizosphereMATATDRQKTAKENFAVPDNGERKVSLLVVEDDENISTAISE
Ga0075436_10107757813300006914Populus RhizosphereMAIATDRQKSPKDNFSLPDAGERRVSLLVVEDDENIST
Ga0079216_1000894313300006918Agricultural SoilMTTIATDRQKTSNNNPPAESGERKISLLVVEDDENISSAISEYFSRAGYDVKTV
Ga0079216_1015429413300006918Agricultural SoilMATATDRQKIAKENFPVPDSGERKVSLLVVEDDENISTAISEYF
Ga0079216_1084008113300006918Agricultural SoilMTTIATDRQKTSNNNPPAESGERKISLLVVEDDENISSAISEYFSRAGYDVKTVE
Ga0105240_1122648223300009093Corn RhizosphereMATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTA
Ga0105240_1192183223300009093Corn RhizosphereMTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAGYNV
Ga0105240_1236629823300009093Corn RhizosphereMATATDRQKTAKEGFPVPDSGERKVSLLVVEDDENISTAISEYFSR
Ga0105247_1024544313300009101Switchgrass RhizosphereMMATATDRQKTAKENFAPDSGERKVSLLVVEDDENIST
Ga0105243_1010624713300009148Miscanthus RhizosphereMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTA
Ga0105243_1030331323300009148Miscanthus RhizosphereMTNTATDRQKISKDNGHPAEPTERKISLLVVEDDENISSAI
Ga0105243_1205489613300009148Miscanthus RhizosphereMTTATDRQKTGKENFQVPDSGERKVSLLVVEDDENISTAISEYFSRAGY
Ga0105243_1207906213300009148Miscanthus RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEY
Ga0075423_1025402823300009162Populus RhizosphereMATATDRQKVLRDNLSIPDAGERKVSLLVVEDDENISTAISEYFSR
Ga0105241_1170557023300009174Corn RhizosphereMATATDRQKLAKENFPVPDSGERKVSLLVVEDDENISTAISE
Ga0105242_1316337513300009176Miscanthus RhizosphereMTNTAADRQKTSKDNSQPAEALERRVSLLVVEDDENISSAISEYFSR
Ga0105237_1166520923300009545Corn RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAIS
Ga0126307_1156702423300009789Serpentine SoilMAMATATDRQKTAKENFAVPDSGERKVSLLVVEDD
Ga0126305_1113431423300010036Serpentine SoilMATATDRQKTVKENFAMPESGERKVSLLVVEDDENISTAISEYFS
Ga0126314_1072565413300010042Serpentine SoilMATATDRQKTGKENFGVPDSGERKVSLLVVEDDENISTAISEYF
Ga0126380_1147649913300010043Tropical Forest SoilMATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAISEYF
Ga0126306_1069689813300010166Serpentine SoilMATATDRQKTAKENFAMPESGERKVSLLVVEDDENISTAISEYFSRAG
Ga0134128_1032494033300010373Terrestrial SoilMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISEYF*
Ga0134128_1312578813300010373Terrestrial SoilMATATDRQKTAKDGLPVPETGERKVSLLVVEDDENISTAIS
Ga0105239_1151627223300010375Corn RhizosphereMATATDRQKITKDNFPVPDSGERKVSLLVVEDDENIS
Ga0134127_1056020533300010399Terrestrial SoilMATATDRQKTAKENFAVPDSGERKVSLLVVEDDEN
Ga0134122_1175909523300010400Terrestrial SoilMTNTATDRQKTSRDNSQPTEPLEGKVSLLVVEDDENISSAISEYFSRAGYNVKTV
Ga0134123_1087213613300010403Terrestrial SoilMATATDRQKTAKENFSVPDSGERKVSLLVVEDDENISTAISE
Ga0105246_1096241823300011119Miscanthus RhizosphereMTNTAADRQKTSRDNSQPAEPLERRVSLLVVEDDENISSAISEYFSRAG
Ga0137392_1132893523300011269Vadose Zone SoilMTTTATDRQKNPRDTSHPTEPGERKISLLVVEDDENISSAISEYFS
Ga0137366_1061498213300012354Vadose Zone SoilMPIITDKQIKANKESYSVLDSGERKISLLVVEDDENISTAISEYFSRAGYT
Ga0157282_1015488413300012904SoilMTNTAADRQKTSRDNSRPAEPLESRVSLLVVEDDENISSAISEYFS
Ga0126375_1033856013300012948Tropical Forest SoilMATATDRQKIAKENSTVPDAGERRISLLVVEDDENISSAIHEYLSRAG
Ga0164299_1065460223300012958SoilMATATDRQKLAKENFPVPDSGERKVSLLVVEDDENISTAI
Ga0164305_1125718613300012989SoilMTTTATDRQKNPRENSHPTEPGERKVSLLVVEDDENI
Ga0157369_1170225723300013105Corn RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTA
Ga0157378_1169237513300013297Miscanthus RhizosphereMTTTATDRQKNPIENSHPTEPAERKVSLLVVEDDENISSAISEYFSRA
Ga0157378_1293018823300013297Miscanthus RhizosphereMGTAAERQKFANDNHQAVEQGERKISLLVVEDDENISTAITEYFSRAGY
Ga0157375_1118629113300013308Miscanthus RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYFSRA
Ga0120183_102422613300013754TerrestrialMATATDRQKSAKENFAVPDSGERKISLLVVEDDENISRAI
Ga0120172_103525713300013765PermafrostMTTTATDRQKTSKDNGHPTEPGERKISLLVVEDDENISSAISEYFSRAGYNVR
Ga0163163_1038752113300014325Switchgrass RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENIST
Ga0180104_112439823300014884SoilLMTNTAADRQKTSRDNSQPAEALERRVSLLVVEDDENISSAISEYFSRAGYNV*
Ga0157379_1154438513300014968Switchgrass RhizosphereMATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENIS
Ga0132255_10191784723300015374Arabidopsis RhizosphereMATATDRQKIAKENFTIPDAGERKVTLLVVEDDEN
Ga0132255_10472038623300015374Arabidopsis RhizosphereMATATDRQKIAKDNFPVPDSGERKVSLLVVEDDENIST
Ga0184638_126873813300018052Groundwater SedimentMTTTATDKQKITKDITQSAEPSERKISLLVVEDDEN
Ga0184640_1003404033300018074Groundwater SedimentMTTTATDKQKISKDNNQPAEPTERKISLLVVEDDENISSAISEYFSRAG
Ga0190274_1264145113300018476SoilMTNTATDRQKTSKDNGHPAEPLERKVSLLVVEDDENISSAISEYFSRA
Ga0190264_1029220913300019377SoilMTTTATDRQKTSRDNNQPAESGERKISLLVVEDDENISSAIS
Ga0207710_1027228113300025900Switchgrass RhizosphereMMATATDRQKTAKENFAPDSGERKVSLLVVEDDENISTAISEYFSR
Ga0207684_1003530913300025910Corn, Switchgrass And Miscanthus RhizosphereMTTTATDRQKTIKDNYPIADPSEHKISLLIVEDDE
Ga0207660_1149180523300025917Corn RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENI
Ga0207644_1039282613300025931Switchgrass RhizosphereMATATDRQKTAKENFSVPESGERKVSLLVVEDDENISTAISEY
Ga0207686_1104912313300025934Miscanthus RhizosphereMTNTAADRQKTSKDNSQPAEALERRVSLLVVEDDENISSAISEYFSRAGY
Ga0207670_1087032723300025936Switchgrass RhizosphereMATATDRQKIAKENLTVTDAGERKVSLLVVEDDENISTAISEYF
Ga0207670_1149908223300025936Switchgrass RhizosphereMATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAISEYFSRAEYHVRT
Ga0207669_1047532013300025937Miscanthus RhizosphereMATATDRQKIVKENFTVPEVGERKVTLLVVEADENIST
Ga0207704_1135067813300025938Miscanthus RhizosphereMATATDRQKTAKENFAVPDSGERKVSLLVVEDDENISTAISEYF
Ga0207711_1191522213300025941Switchgrass RhizosphereMATATDRQKIAKDNFPVPDNGERKVSLLVVEDDENISTAISEYFSRAGYNVKTVE
Ga0207661_1183626313300025944Corn RhizosphereMATATDRQKIAKDTFPVPDSGERKVSLLVVEDDENISTA
Ga0207651_1204131523300025960Switchgrass RhizosphereMMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISE
Ga0207640_1133013213300025981Corn RhizosphereMATATDRQKLAKENFPVPDSGERKVSLLVVEDDEN
Ga0207703_1145776813300026035Switchgrass RhizosphereMTTATDRQKTAKENFAVPESGERKVSLLVVEDDENISTAISEYFSRA
Ga0207641_1237909323300026088Switchgrass RhizosphereMTTATDRQKTAKENFAVPESGERKVSLLVVEDDEN
Ga0207648_1142775223300026089Miscanthus RhizosphereMTITAADKQKTSRDNNQPAEPGERKVSLLVVEDDENISSAISEYFSRAGY
Ga0207676_1080036413300026095Switchgrass RhizosphereMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISE
Ga0207675_10021664333300026118Switchgrass RhizosphereMATATDRQKTAKENFAIPDSGERKVSLLVVEDDENISTAISEYFSRA
Ga0207675_10157863423300026118Switchgrass RhizosphereMTTTATDRQKTSKDSHPTEPSERKISLLVVEDDENISSAISEYFSRAGYN
Ga0207683_1091054713300026121Miscanthus RhizosphereMTNTAADRQKTSGNSQPVEPIERKISLLVVEDDENISSAISEYFSRAGYNVKTV
Ga0207698_1088417233300026142Corn RhizosphereMTNTAADRQKTAKDNGHPAEPIERKISLLVVEDDENISSAI
Ga0268243_108599613300030510SoilMMATATDRQKTAKENFAAPDSGERKVSLLVVEDDENISTAISEYFS
Ga0299906_1131969113300030606SoilMITATTDRQKTAKENQLFEAGERKVALLVVEDDENISTAISEY
Ga0310813_1048130413300031716SoilMATATDRQKTAKDGLPVAETGERKVSLLVVEDDENI
Ga0307405_1133315823300031731RhizosphereMATATDRQKTAKENFAAPESGERKVSLLVVEDDENISTAI
Ga0307471_10361436213300032180Hardwood Forest SoilMATATDRQKTAKENFTVPDAGERKVALLVVEDDENISTAI
Ga0310810_1046142113300033412SoilMATATDRHKTAKENFAAPESGERKVSLLVVEDDENISTAISEYFSRAGYN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.