Basic Information | |
---|---|
Family ID | F086996 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 50 residues |
Representative Sequence | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVLRRRGR |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 44.55 % |
% of genes near scaffold ends (potentially truncated) | 38.18 % |
% of genes from short scaffolds (< 2000 bps) | 83.64 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (10.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (74.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.32% β-sheet: 0.00% Coil/Unstructured: 73.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF07722 | Peptidase_C26 | 49.09 |
PF03928 | HbpS-like | 2.73 |
PF00903 | Glyoxalase | 1.82 |
PF13685 | Fe-ADH_2 | 1.82 |
PF13191 | AAA_16 | 0.91 |
PF13561 | adh_short_C2 | 0.91 |
PF00282 | Pyridoxal_deC | 0.91 |
PF01243 | Putative_PNPOx | 0.91 |
PF07992 | Pyr_redox_2 | 0.91 |
PF10094 | DUF2332 | 0.91 |
PF10823 | DUF2568 | 0.91 |
PF03486 | HI0933_like | 0.91 |
PF06348 | DUF1059 | 0.91 |
PF00877 | NLPC_P60 | 0.91 |
PF05988 | DUF899 | 0.91 |
PF12681 | Glyoxalase_2 | 0.91 |
PF14329 | DUF4386 | 0.91 |
PF13649 | Methyltransf_25 | 0.91 |
PF00753 | Lactamase_B | 0.91 |
PF12697 | Abhydrolase_6 | 0.91 |
PF00171 | Aldedh | 0.91 |
PF08447 | PAS_3 | 0.91 |
PF02774 | Semialdhyde_dhC | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.82 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.82 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.91 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.91 |
COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.91 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.91 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.91 |
COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.91 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.91 |
COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.91 |
COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.91 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.91 |
COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.91 |
COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.91 |
COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.91 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.00 % |
Unclassified | root | N/A | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001686|C688J18823_10057205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2702 | Open in IMG/M |
3300001686|C688J18823_10114498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1872 | Open in IMG/M |
3300001686|C688J18823_10569507 | Not Available | 724 | Open in IMG/M |
3300002568|C688J35102_119709433 | Not Available | 754 | Open in IMG/M |
3300002568|C688J35102_119781814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 773 | Open in IMG/M |
3300002568|C688J35102_120322264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 989 | Open in IMG/M |
3300002568|C688J35102_120487103 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300002568|C688J35102_120922310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2373 | Open in IMG/M |
3300002568|C688J35102_120952630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2946 | Open in IMG/M |
3300002568|C688J35102_120962095 | All Organisms → cellular organisms → Bacteria | 3272 | Open in IMG/M |
3300004081|Ga0063454_101390306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 594 | Open in IMG/M |
3300004114|Ga0062593_103327567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300004463|Ga0063356_100156684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2608 | Open in IMG/M |
3300004479|Ga0062595_100249882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1149 | Open in IMG/M |
3300004479|Ga0062595_102341293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 528 | Open in IMG/M |
3300004480|Ga0062592_102499835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 519 | Open in IMG/M |
3300005093|Ga0062594_102035941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 615 | Open in IMG/M |
3300005329|Ga0070683_101069989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 775 | Open in IMG/M |
3300005329|Ga0070683_101167734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 740 | Open in IMG/M |
3300005331|Ga0070670_101818191 | Not Available | 561 | Open in IMG/M |
3300005334|Ga0068869_101876151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 537 | Open in IMG/M |
3300005336|Ga0070680_100946733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 743 | Open in IMG/M |
3300005337|Ga0070682_100608900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 864 | Open in IMG/M |
3300005337|Ga0070682_101241965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 630 | Open in IMG/M |
3300005338|Ga0068868_100137877 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
3300005338|Ga0068868_100255597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1476 | Open in IMG/M |
3300005339|Ga0070660_100651983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 882 | Open in IMG/M |
3300005341|Ga0070691_10791818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 577 | Open in IMG/M |
3300005344|Ga0070661_101194218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 636 | Open in IMG/M |
3300005347|Ga0070668_102252568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 504 | Open in IMG/M |
3300005355|Ga0070671_101644198 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005356|Ga0070674_100936809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 756 | Open in IMG/M |
3300005437|Ga0070710_10711512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 710 | Open in IMG/M |
3300005441|Ga0070700_101392514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 592 | Open in IMG/M |
3300005455|Ga0070663_100261465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1373 | Open in IMG/M |
3300005455|Ga0070663_101829181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 545 | Open in IMG/M |
3300005456|Ga0070678_100766664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 874 | Open in IMG/M |
3300005457|Ga0070662_100593764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 931 | Open in IMG/M |
3300005459|Ga0068867_100102883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2184 | Open in IMG/M |
3300005466|Ga0070685_10528583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 839 | Open in IMG/M |
3300005539|Ga0068853_100872095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 864 | Open in IMG/M |
3300005544|Ga0070686_100390646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1056 | Open in IMG/M |
3300005563|Ga0068855_101464024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 702 | Open in IMG/M |
3300005564|Ga0070664_100135212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2167 | Open in IMG/M |
3300005578|Ga0068854_100612677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 931 | Open in IMG/M |
3300005615|Ga0070702_100416311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 966 | Open in IMG/M |
3300005615|Ga0070702_101736709 | Not Available | 520 | Open in IMG/M |
3300005616|Ga0068852_100989088 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005834|Ga0068851_10534543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 707 | Open in IMG/M |
3300005844|Ga0068862_100206887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1772 | Open in IMG/M |
3300006755|Ga0079222_11100511 | Not Available | 698 | Open in IMG/M |
3300006844|Ga0075428_101512574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 703 | Open in IMG/M |
3300006854|Ga0075425_101339031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 811 | Open in IMG/M |
3300006871|Ga0075434_100714974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1019 | Open in IMG/M |
3300006931|Ga0097620_101331415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 792 | Open in IMG/M |
3300006954|Ga0079219_11547654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 604 | Open in IMG/M |
3300009094|Ga0111539_10891699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1034 | Open in IMG/M |
3300009094|Ga0111539_11377792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 818 | Open in IMG/M |
3300009148|Ga0105243_11705896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 659 | Open in IMG/M |
3300009156|Ga0111538_11298878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 919 | Open in IMG/M |
3300009174|Ga0105241_11621507 | Not Available | 626 | Open in IMG/M |
3300009176|Ga0105242_12057794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 614 | Open in IMG/M |
3300010399|Ga0134127_10996170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 898 | Open in IMG/M |
3300012212|Ga0150985_101141621 | Not Available | 533 | Open in IMG/M |
3300012212|Ga0150985_110718855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter terrae | 769 | Open in IMG/M |
3300012469|Ga0150984_114014274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
3300012469|Ga0150984_114855211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter terrae | 946 | Open in IMG/M |
3300013102|Ga0157371_11109670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 607 | Open in IMG/M |
3300013296|Ga0157374_10098234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2803 | Open in IMG/M |
3300013306|Ga0163162_10803651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis | 1058 | Open in IMG/M |
3300014326|Ga0157380_10144247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2050 | Open in IMG/M |
3300014969|Ga0157376_11453951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 718 | Open in IMG/M |
3300014969|Ga0157376_11659492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 674 | Open in IMG/M |
3300015371|Ga0132258_10544253 | All Organisms → cellular organisms → Bacteria | 2909 | Open in IMG/M |
3300015371|Ga0132258_11921783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1490 | Open in IMG/M |
3300019356|Ga0173481_10543105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300025321|Ga0207656_10053440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
3300025899|Ga0207642_10014270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2927 | Open in IMG/M |
3300025900|Ga0207710_10185759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1022 | Open in IMG/M |
3300025904|Ga0207647_10326329 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300025919|Ga0207657_10055487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3421 | Open in IMG/M |
3300025925|Ga0207650_10245925 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta americana | 1447 | Open in IMG/M |
3300025931|Ga0207644_11531226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
3300025931|Ga0207644_11822043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 509 | Open in IMG/M |
3300025937|Ga0207669_10293212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
3300025938|Ga0207704_10925812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 734 | Open in IMG/M |
3300025938|Ga0207704_11294339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 623 | Open in IMG/M |
3300025949|Ga0207667_11242558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 723 | Open in IMG/M |
3300025972|Ga0207668_10416671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1139 | Open in IMG/M |
3300025981|Ga0207640_11918898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 536 | Open in IMG/M |
3300025981|Ga0207640_12185832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 502 | Open in IMG/M |
3300026035|Ga0207703_10060829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3090 | Open in IMG/M |
3300026035|Ga0207703_10165447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1940 | Open in IMG/M |
3300026067|Ga0207678_10497212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1063 | Open in IMG/M |
3300026075|Ga0207708_10069213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2702 | Open in IMG/M |
3300026089|Ga0207648_11027691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 772 | Open in IMG/M |
3300026116|Ga0207674_10656981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1012 | Open in IMG/M |
3300026118|Ga0207675_101694254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 652 | Open in IMG/M |
3300026121|Ga0207683_10227947 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300027907|Ga0207428_10584364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 806 | Open in IMG/M |
3300028380|Ga0268265_10058232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2949 | Open in IMG/M |
3300028381|Ga0268264_10042411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3766 | Open in IMG/M |
3300028587|Ga0247828_10021695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2525 | Open in IMG/M |
3300028589|Ga0247818_11033552 | Not Available | 582 | Open in IMG/M |
3300028592|Ga0247822_11841729 | Not Available | 517 | Open in IMG/M |
3300028596|Ga0247821_11184245 | Not Available | 519 | Open in IMG/M |
3300030511|Ga0268241_10088934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 705 | Open in IMG/M |
3300031901|Ga0307406_11275764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 640 | Open in IMG/M |
3300031938|Ga0308175_103203051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 508 | Open in IMG/M |
3300031996|Ga0308176_12474951 | Not Available | 553 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 10.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 10.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J18823_100572055 | 3300001686 | Soil | MPSTSPEHSFCYVASDVPVGMTLSAWRGDKVRAEGGGRRSGLLRRRGR* |
C688J18823_101144983 | 3300001686 | Soil | ARQRRGCRIGAASPRRDTGPMPSTSPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR* |
C688J18823_105695072 | 3300001686 | Soil | MGEVPRGRDTASMLSITAAHSFCYVESDVPAGMTLSSWRGQKVHAEAGGRRPGLLRRRGR |
C688J35102_1197094331 | 3300002568 | Soil | MPSHPSSHSFLYVESDVPAGMTLSSWRDEKARAESRGRRSGFLRRLGGR* |
C688J35102_1197818142 | 3300002568 | Soil | MPSTTPEHTFSYVDCDVPAGMTLSSWRDEKVRATARGRRSGLLRR |
C688J35102_1203222642 | 3300002568 | Soil | MGAGLPRPDTEPMPSTTQDHTFCYVESDVPAGMTLSAWRSEKVRAETGGRRSGLLRRRGR |
C688J35102_1204871032 | 3300002568 | Soil | MPSTTAEHTFSYVDSDVPAGMTLTCWRDEKVRAAARGRRSGLLRRRGR* |
C688J35102_1209223104 | 3300002568 | Soil | MPSTTPEHTFCYVETDVPAGMTLSSWRDEKVRAEARGRRSGLLRRRGR* |
C688J35102_1209526304 | 3300002568 | Soil | MPSTSPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR* |
C688J35102_1209620953 | 3300002568 | Soil | MPSTTPEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR* |
Ga0063454_1013903062 | 3300004081 | Soil | TQDHTFCYVESDVPAGMTLSAWRSEKVRAETGGRRSGLLRRRGR* |
Ga0062593_1033275672 | 3300004114 | Soil | MPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR* |
Ga0063356_1001566842 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPSTTPEHTFCYVESDVPAGMTLSSWRSEKVRAQAGGRRSGVLRRRGR* |
Ga0062595_1002498821 | 3300004479 | Soil | MPAVTPDHSFCYVESDVPAGMTLSSWRGEKARAEARGRRSGLLRRRGR* |
Ga0062595_1023412931 | 3300004479 | Soil | PDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0062592_1024998351 | 3300004480 | Soil | MGAIARRRDTAPMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR |
Ga0062594_1020359411 | 3300005093 | Soil | TFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0070683_1010699892 | 3300005329 | Corn Rhizosphere | PRKVAYSPSPTRACRMGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR* |
Ga0070683_1011677342 | 3300005329 | Corn Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0070670_1018181911 | 3300005331 | Switchgrass Rhizosphere | MGAAPSRRDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR |
Ga0068869_1018761512 | 3300005334 | Miscanthus Rhizosphere | MGAAPPRQDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR |
Ga0070680_1009467332 | 3300005336 | Corn Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRAGVLRRRG |
Ga0070682_1006089001 | 3300005337 | Corn Rhizosphere | DHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0070682_1012419651 | 3300005337 | Corn Rhizosphere | ASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGPRRRRGR* |
Ga0068868_1001378772 | 3300005338 | Miscanthus Rhizosphere | MPSTSPEHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR* |
Ga0068868_1002555972 | 3300005338 | Miscanthus Rhizosphere | MPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0070660_1006519832 | 3300005339 | Corn Rhizosphere | MGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR |
Ga0070691_107918182 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0070661_1011942182 | 3300005344 | Corn Rhizosphere | MGAIARRRDTASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR |
Ga0070668_1022525681 | 3300005347 | Switchgrass Rhizosphere | DHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR* |
Ga0070671_1016441982 | 3300005355 | Switchgrass Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPHRRSGVLRRRGR* |
Ga0070674_1009368092 | 3300005356 | Miscanthus Rhizosphere | MGAAPPRQDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAESGGRRSGLLRRRGR |
Ga0070710_107115122 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEAVGRRSGVLRRRGR* |
Ga0070700_1013925141 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR* |
Ga0070663_1002614652 | 3300005455 | Corn Rhizosphere | MGAIARRRDTAPMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR |
Ga0070663_1018291812 | 3300005455 | Corn Rhizosphere | DTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR* |
Ga0070678_1007666642 | 3300005456 | Miscanthus Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR* |
Ga0070662_1005937641 | 3300005457 | Corn Rhizosphere | PDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR* |
Ga0068867_1001028832 | 3300005459 | Miscanthus Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0070685_105285832 | 3300005466 | Switchgrass Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRGR* |
Ga0068853_1008720952 | 3300005539 | Corn Rhizosphere | MGAAPPRRDTAPMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0070686_1003906461 | 3300005544 | Switchgrass Rhizosphere | HTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRGR* |
Ga0068855_1014640242 | 3300005563 | Corn Rhizosphere | MGAAAPRRDTAPMPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR |
Ga0070664_1001352123 | 3300005564 | Corn Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0068854_1006126772 | 3300005578 | Corn Rhizosphere | APTRACRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0070702_1004163112 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR |
Ga0070702_1017367091 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRSGVLRRRGR* |
Ga0068852_1009890882 | 3300005616 | Corn Rhizosphere | MPSTSPAHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR* |
Ga0068851_105345431 | 3300005834 | Corn Rhizosphere | PDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0068862_1002068872 | 3300005844 | Switchgrass Rhizosphere | MGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR |
Ga0079222_111005112 | 3300006755 | Agricultural Soil | MPSIAPELTFSYVESDVPAGMTLSSWRGEKVRAESRRRRDGLVRRHGR* |
Ga0075428_1015125742 | 3300006844 | Populus Rhizosphere | MAAAAPRRDTAPMPAAIPDHTFRYVESDVPAGMTLSSWRGEKVRAEARSRRSGLLRRRGR |
Ga0075425_1013390312 | 3300006854 | Populus Rhizosphere | PTRGCRMGAAPPRRDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0075434_1007149741 | 3300006871 | Populus Rhizosphere | RACRMGAAPPRRDTAPMLSTTPDHTFRYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0097620_1013314151 | 3300006931 | Switchgrass Rhizosphere | DHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR* |
Ga0079219_115476541 | 3300006954 | Agricultural Soil | TFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR* |
Ga0111539_108916991 | 3300009094 | Populus Rhizosphere | MGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSGRADKARAEAGARRSGLRRRRGR |
Ga0111539_113777921 | 3300009094 | Populus Rhizosphere | MLSTTLEYTFCYVESDVPAGMTLSSWRGEKVRAEGRGRRSGLLRRRGR* |
Ga0105243_117058962 | 3300009148 | Miscanthus Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR* |
Ga0111538_112988782 | 3300009156 | Populus Rhizosphere | MPAAIPDHTFRYVESDVPAGMTLSSWRGEKVRAEARSRRSGLLRRRGR* |
Ga0105241_116215072 | 3300009174 | Corn Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR* |
Ga0105242_120577941 | 3300009176 | Miscanthus Rhizosphere | DHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR* |
Ga0134127_109961702 | 3300010399 | Terrestrial Soil | MPSTSPSHTFSYVESDVAEGMTLSAWRAEKVRSEAGGRRSGLLRRRGR* |
Ga0150985_1011416212 | 3300012212 | Avena Fatua Rhizosphere | MLSITAAHSFCYVESDVPAGMTLSSWRGEKVRAEAGGRRPGLLRRRGR* |
Ga0150985_1107188551 | 3300012212 | Avena Fatua Rhizosphere | TPEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR* |
Ga0150984_1140142741 | 3300012469 | Avena Fatua Rhizosphere | SPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR* |
Ga0150984_1148552111 | 3300012469 | Avena Fatua Rhizosphere | GAEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR* |
Ga0157371_111096702 | 3300013102 | Corn Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR* |
Ga0157374_100982341 | 3300013296 | Miscanthus Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR* |
Ga0163162_108036511 | 3300013306 | Switchgrass Rhizosphere | MPAVTPDHTFCYVESDVPAGMTLSSWRGEKARAEARGRRSGLLRRRGR* |
Ga0157380_101442472 | 3300014326 | Switchgrass Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR* |
Ga0157376_114539511 | 3300014969 | Miscanthus Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSG |
Ga0157376_116594922 | 3300014969 | Miscanthus Rhizosphere | MPSTSPDHTFCYVDSDVPAGMTLSSWRSEKVRAEGRGRRSGVLRRRGR* |
Ga0132258_105442534 | 3300015371 | Arabidopsis Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVLRRRGR* |
Ga0132258_119217832 | 3300015371 | Arabidopsis Rhizosphere | MASTTPEHSFSYVESDVPAGMTLSAWRGDRVRAEAGDRRSGLLRRRGR* |
Ga0173481_105431052 | 3300019356 | Soil | MPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR |
Ga0207656_100534402 | 3300025321 | Corn Rhizosphere | MPSTSPEHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR |
Ga0207642_100142705 | 3300025899 | Miscanthus Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR |
Ga0207710_101857592 | 3300025900 | Switchgrass Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0207647_103263292 | 3300025904 | Corn Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVR |
Ga0207657_100554872 | 3300025919 | Corn Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0207650_102459252 | 3300025925 | Switchgrass Rhizosphere | MGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR |
Ga0207644_115312261 | 3300025931 | Switchgrass Rhizosphere | AAAPRRETPPMPTATPEHTFCYVDCDVPAGMTLSSWRGEKVRAAARGRRSGFLRRRGR |
Ga0207644_118220431 | 3300025931 | Switchgrass Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPHRRSGVLRRRGR |
Ga0207669_102932121 | 3300025937 | Miscanthus Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRS |
Ga0207704_109258122 | 3300025938 | Miscanthus Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRSGVLRRRGR |
Ga0207704_112943392 | 3300025938 | Miscanthus Rhizosphere | ESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR |
Ga0207667_112425582 | 3300025949 | Corn Rhizosphere | MPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR |
Ga0207668_104166711 | 3300025972 | Switchgrass Rhizosphere | TAPTRACRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR |
Ga0207640_119188982 | 3300025981 | Corn Rhizosphere | SFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR |
Ga0207640_121858322 | 3300025981 | Corn Rhizosphere | APPRRDTAPMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0207703_100608291 | 3300026035 | Switchgrass Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGG |
Ga0207703_101654473 | 3300026035 | Switchgrass Rhizosphere | CRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0207678_104972122 | 3300026067 | Corn Rhizosphere | MGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR |
Ga0207708_100692132 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR |
Ga0207648_110276911 | 3300026089 | Miscanthus Rhizosphere | MPSTSPAHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR |
Ga0207674_106569812 | 3300026116 | Corn Rhizosphere | MGAIARRRDTASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR |
Ga0207675_1016942542 | 3300026118 | Switchgrass Rhizosphere | YVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR |
Ga0207683_102279474 | 3300026121 | Miscanthus Rhizosphere | MPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0207428_105843641 | 3300027907 | Populus Rhizosphere | PDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR |
Ga0268265_100582323 | 3300028380 | Switchgrass Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRGR |
Ga0268264_100424111 | 3300028381 | Switchgrass Rhizosphere | MPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRR |
Ga0247828_100216951 | 3300028587 | Soil | PDHTFCYVESDVPAGMTLSSWRSEKVRAESGGRRSGLLRRRGR |
Ga0247818_110335522 | 3300028589 | Soil | MPSTTPEHSFCYVESDVPAGMTLSAWRGEKARAEVSGRRSGLLRRRAR |
Ga0247822_118417291 | 3300028592 | Soil | MGAASLRRDTAPMPSTTPDHAFCYVESDVPAGMTLSTWRGEKVRAEAGGRRSGMFRRRGR |
Ga0247821_111842451 | 3300028596 | Soil | MPSTTPDHAFCYVESDVPAGMTLSTWRGEKVRAEAGGRRSGMFRRRGR |
Ga0268241_100889341 | 3300030511 | Soil | MPSASPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGLLRRRPRGH |
Ga0307406_112757642 | 3300031901 | Rhizosphere | PMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEAHGRRRGVLRRRGR |
Ga0308175_1032030512 | 3300031938 | Soil | MPSITPEHTFCYVESDVPAGVTLSSWRGEKVRAEAGGRRSGLLRRRGN |
Ga0308176_124749511 | 3300031996 | Soil | MPSIASQHTFCYVESDVPAGMTLSSWRGEKVRVEARRRRSRLLR |
⦗Top⦘ |