NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086992

Metagenome / Metatranscriptome Family F086992

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086992
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 44 residues
Representative Sequence MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARR
Number of Associated Samples 97
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.73 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.364 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(24.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.636 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.29%    β-sheet: 0.00%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF02769AIRS_C 68.18
PF13458Peripla_BP_6 5.45
PF01070FMN_dh 1.82
PF01029NusB 1.82
PF00677Lum_binding 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 1.82
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 1.82
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.36 %
UnclassifiedrootN/A3.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01CRNKTAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300000890|JGI11643J12802_12001762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1005Open in IMG/M
3300002911|JGI25390J43892_10019845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1613Open in IMG/M
3300004081|Ga0063454_100637152All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300004081|Ga0063454_101188725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium630Open in IMG/M
3300004081|Ga0063454_101459638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium583Open in IMG/M
3300004152|Ga0062386_100521606All Organisms → cellular organisms → Bacteria → Proteobacteria966Open in IMG/M
3300004643|Ga0062591_101530484All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005167|Ga0066672_10862906All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005332|Ga0066388_100504698All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300005332|Ga0066388_107988707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris → Blastochloris sulfoviridis529Open in IMG/M
3300005332|Ga0066388_108442612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300005446|Ga0066686_11053467All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300005457|Ga0070662_101721114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300005467|Ga0070706_101501259All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005468|Ga0070707_101497441All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005471|Ga0070698_100231003All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300005548|Ga0070665_101945959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium593Open in IMG/M
3300005554|Ga0066661_10606033All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005568|Ga0066703_10513487All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005616|Ga0068852_101724659All Organisms → cellular organisms → Bacteria → Proteobacteria649Open in IMG/M
3300005713|Ga0066905_100046068All Organisms → cellular organisms → Bacteria2630Open in IMG/M
3300005713|Ga0066905_101402797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300005764|Ga0066903_101112637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris1457Open in IMG/M
3300005764|Ga0066903_101319368All Organisms → cellular organisms → Bacteria → Proteobacteria1349Open in IMG/M
3300005937|Ga0081455_10660428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris672Open in IMG/M
3300006049|Ga0075417_10014052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3059Open in IMG/M
3300006755|Ga0079222_11198170All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300006904|Ga0075424_100680573All Organisms → cellular organisms → Bacteria → Proteobacteria1098Open in IMG/M
3300009094|Ga0111539_11805689All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009551|Ga0105238_10431383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1314Open in IMG/M
3300009792|Ga0126374_11039588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium645Open in IMG/M
3300009792|Ga0126374_11593282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300010371|Ga0134125_10144508All Organisms → cellular organisms → Bacteria2649Open in IMG/M
3300010373|Ga0134128_10868875All Organisms → cellular organisms → Bacteria → Proteobacteria999Open in IMG/M
3300010376|Ga0126381_101643620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium928Open in IMG/M
3300010398|Ga0126383_10548181All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300010398|Ga0126383_12134564All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012096|Ga0137389_11599188All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012354|Ga0137366_10444169All Organisms → cellular organisms → Bacteria → Proteobacteria941Open in IMG/M
3300012469|Ga0150984_115710083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1547Open in IMG/M
3300012892|Ga0157294_10124420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium690Open in IMG/M
3300012929|Ga0137404_11679016Not Available590Open in IMG/M
3300012930|Ga0137407_11753585All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300012930|Ga0137407_11773608All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300012961|Ga0164302_10246445All Organisms → cellular organisms → Bacteria → Proteobacteria1132Open in IMG/M
3300012971|Ga0126369_10669660All Organisms → cellular organisms → Bacteria → Proteobacteria1113Open in IMG/M
3300012971|Ga0126369_13496203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300012985|Ga0164308_10012338All Organisms → cellular organisms → Bacteria4710Open in IMG/M
3300012986|Ga0164304_11885682Not Available500Open in IMG/M
3300015371|Ga0132258_11581886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1655Open in IMG/M
3300015373|Ga0132257_100109741All Organisms → cellular organisms → Bacteria3188Open in IMG/M
3300016270|Ga0182036_10925860All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300016319|Ga0182033_11266329All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300016387|Ga0182040_10178957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1540Open in IMG/M
3300016404|Ga0182037_10202547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1540Open in IMG/M
3300016445|Ga0182038_11208559All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300017974|Ga0187777_10673077Not Available733Open in IMG/M
3300018468|Ga0066662_11583318All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300019767|Ga0190267_10215962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium914Open in IMG/M
3300020583|Ga0210401_10619353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris944Open in IMG/M
3300021401|Ga0210393_11415264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300021475|Ga0210392_11003784All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300021479|Ga0210410_11263618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300021560|Ga0126371_10898778All Organisms → cellular organisms → Bacteria → Proteobacteria1030Open in IMG/M
3300025922|Ga0207646_11897861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris508Open in IMG/M
3300025942|Ga0207689_11531254Not Available556Open in IMG/M
3300026023|Ga0207677_11235082All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300026297|Ga0209237_1135541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300026309|Ga0209055_1242861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300026310|Ga0209239_1157210All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300026552|Ga0209577_10162061All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300027882|Ga0209590_10008848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4603Open in IMG/M
3300027903|Ga0209488_10904924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium618Open in IMG/M
3300027907|Ga0207428_10167210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1667Open in IMG/M
3300028712|Ga0307285_10180149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium587Open in IMG/M
3300028720|Ga0307317_10192264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium688Open in IMG/M
3300028720|Ga0307317_10296913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium546Open in IMG/M
3300028793|Ga0307299_10268342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris641Open in IMG/M
3300031093|Ga0308197_10163481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium727Open in IMG/M
3300031226|Ga0307497_10175609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium910Open in IMG/M
3300031231|Ga0170824_128376764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1542Open in IMG/M
3300031469|Ga0170819_16097559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium733Open in IMG/M
3300031572|Ga0318515_10777171All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031680|Ga0318574_10223502All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300031681|Ga0318572_10684884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300031682|Ga0318560_10316416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium841Open in IMG/M
3300031720|Ga0307469_11339125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031771|Ga0318546_10372279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris996Open in IMG/M
3300031782|Ga0318552_10098305All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300031792|Ga0318529_10336777All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031793|Ga0318548_10412258All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300031797|Ga0318550_10228722All Organisms → cellular organisms → Bacteria → Proteobacteria901Open in IMG/M
3300031821|Ga0318567_10062429All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300031832|Ga0318499_10025237All Organisms → cellular organisms → Bacteria2104Open in IMG/M
3300031890|Ga0306925_10351555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1583Open in IMG/M
3300031890|Ga0306925_11399386All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300031890|Ga0306925_12190511All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031893|Ga0318536_10524852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300031941|Ga0310912_11270433All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031954|Ga0306926_12740709All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032001|Ga0306922_12029427All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032043|Ga0318556_10087257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1566Open in IMG/M
3300032054|Ga0318570_10368724All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300032063|Ga0318504_10468664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris602Open in IMG/M
3300032076|Ga0306924_10008813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10200Open in IMG/M
3300032180|Ga0307471_101067395All Organisms → cellular organisms → Bacteria → Proteobacteria974Open in IMG/M
3300032205|Ga0307472_102443817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300034090|Ga0326723_0182570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris927Open in IMG/M
3300034149|Ga0364929_0073313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1059Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.91%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.91%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.91%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_045974402170459017Switchgrass, Maize And Mischanthus LitterMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNV
JGI11643J12802_1200176223300000890SoilMHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRYVPSF
JGI25390J43892_1001984533300002911Grasslands SoilMHDMTGLVRPAKDYTPSDNPRFLELHRRFPTIAYLRQRAR
Ga0063454_10063715223300004081SoilMHDTTALARPASPYNPADNPHFSELHRRFPTVAYLRRHARRQVP
Ga0063454_10118872513300004081SoilMHDTTALARPANPYNPADNPRFSKLHRRFPTVAYLRRHARRQVPNFA
Ga0063454_10145963813300004081SoilMHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVP
Ga0062386_10052160613300004152Bog Forest SoilMDDTTALVRPAAKDYTPADNPRFLGLHRRFPSIAYLRHHARRH
Ga0062591_10153048413300004643SoilMHDTTALTRPTAARKDYTPADNPAFVKLHRRFPAVPYLRR
Ga0066672_1086290623300005167SoilMDDRTALVRPATKDYAPADDPSFPRLHRRFPTVAYLRRHAR
Ga0066388_10050469813300005332Tropical Forest SoilMQDTTAVTRPNVKIYTPADNPGFTRLHRRFPTVAYLRKQA
Ga0066388_10798870723300005332Tropical Forest SoilMHDTTAVTRPNVKVYTPADNPRFVALHRRFPTVAYLRRQARRRLPH
Ga0066388_10844261223300005332Tropical Forest SoilMDDRTGLARTAADDYTPADNPSFVQLHRRFPTIHHLRRHARARLPRFAFEYLD
Ga0066686_1105346723300005446SoilMHDTTAVARPAAQDHTPADNPRFVKLHRRFPTTAHLRAHA
Ga0070662_10172111413300005457Corn RhizosphereMQDTTALVSPAAKDYVPADNPRFVKLHRRFPTVLYLRRHARRHVPRFAFEYM
Ga0070706_10150125913300005467Corn, Switchgrass And Miscanthus RhizosphereMHDTTALVRSAENDYTPVDNPRFLKLHRRFPTIAYLRQHARSHV
Ga0070707_10149744113300005468Corn, Switchgrass And Miscanthus RhizosphereMQDTTALVRSAASDYTPADNPRFLKLHRRFPTVAYLRQHARSH
Ga0070698_10023100333300005471Corn, Switchgrass And Miscanthus RhizosphereMHDTTAVTRPNVKVYTPADNPRFPKLHRRFPTVAYLRRQARRKLPHFAFEYC
Ga0070665_10194595923300005548Switchgrass RhizosphereMHDTTALARPASPYNPADNPRFSKLHRRFPTVAYLRRHARRQVP
Ga0066661_1060603323300005554SoilMHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHARS
Ga0066703_1051348713300005568SoilMHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHA
Ga0068852_10172465913300005616Corn RhizosphereMHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRHARR
Ga0066905_10004606833300005713Tropical Forest SoilMHDTPALHRPNAKVYTPADNPRFVKLHRRFPTVAYLRRQARRKL
Ga0066905_10140279723300005713Tropical Forest SoilMQDTTALVRPAVRNYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEYMD
Ga0066903_10111263733300005764Tropical Forest SoilMQDTTALVRPAAKDYTPADNPRFLKLHRRFPTIFYLRQHARRHVP
Ga0066903_10131936833300005764Tropical Forest SoilMHDTTAVAKPNARIYLPAENPRFAALHRRFPTVAYLRKHAR
Ga0081455_1066042823300005937Tabebuia Heterophylla RhizosphereMHDTTAVTRPNVKVYTPADNPRFPKLHRRFPTVAYLRRHAR
Ga0075417_1001405213300006049Populus RhizosphereMHDTTGLVRPAKDYTPADNPRFLELHRRFPTIAYLRE
Ga0079222_1119817023300006755Agricultural SoilMQDMTALVPPPAQDYVPADNPRFVKLHRRFPTILYLRRHARR
Ga0075424_10068057313300006904Populus RhizosphereMQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFAF
Ga0111539_1180568913300009094Populus RhizosphereMQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFAFEYMD
Ga0105238_1043138313300009551Corn RhizosphereMHDTTALARPASPYNPADNPRFSALHRRFPTVAYL
Ga0126374_1103958823300009792Tropical Forest SoilMHDTTALARPAAAYTPADNPRFLKLHRRFPTVAYLRRRARRHV
Ga0126374_1159328223300009792Tropical Forest SoilMHDTTALVWPAANDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRF
Ga0134125_1014450813300010371Terrestrial SoilMQDTTALVPPAAKDYVPADNPRFVKLHRRFPTVLYLRRH
Ga0134128_1086887513300010373Terrestrial SoilMQDTTALVSPAAKDYVPADNPRFVKLHRRFPTVLY
Ga0126381_10164362013300010376Tropical Forest SoilMQDTTASVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPSFAFEYMD
Ga0126383_1054818113300010398Tropical Forest SoilMQDTTALVRPAAKGYTPADNPRFPKLHRRFPTILYLRQHARRH
Ga0126383_1213456423300010398Tropical Forest SoilMQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEYM
Ga0137389_1159918823300012096Vadose Zone SoilMHDTTALTRPAAATKDYTPADNPGFVKLHRRFPAVAYLRRHAR
Ga0137366_1044416923300012354Vadose Zone SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNVPSFAFEY
Ga0150984_11571008323300012469Avena Fatua RhizosphereMHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVPNFAFE
Ga0157294_1012442013300012892SoilMHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRYVPSFA
Ga0137404_1167901623300012929Vadose Zone SoilMHDTTALHRPNAKIYTPADNPRFPALHRRFPTVAYLRR
Ga0137407_1175358513300012930Vadose Zone SoilMDDRTTVARPAVKDYAPADNPSFSKLHRQFPTVAYLR
Ga0137407_1177360823300012930Vadose Zone SoilMHDTTAVTKPNVKIYTPADNPRFVALHRRFPTVAYLRRHARRKL
Ga0164302_1024644523300012961SoilMHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQV
Ga0126369_1066966023300012971Tropical Forest SoilMQDTTAPVRLAAKGYTPADNPRFLKLHRRFPTIFYLRQHAR
Ga0126369_1349620313300012971Tropical Forest SoilMHDTTALVRPAASDYTPADNPRFVKLHRRFPTLAYL
Ga0164308_1001233873300012985SoilMHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRA
Ga0164304_1188568213300012986SoilMHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRH
Ga0132258_1158188613300015371Arabidopsis RhizosphereMQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFA
Ga0132257_10010974113300015373Arabidopsis RhizosphereMHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARR
Ga0182036_1092586023300016270SoilMHDTTALARSAANDYTPADNPRFVKLHRRFPTVAYLRRHAR
Ga0182033_1126632913300016319SoilMHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHV
Ga0182040_1017895713300016387SoilMQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLRQHARRHVPSFAFEYMD
Ga0182037_1020254713300016404SoilMHDTTALVRPAASDYTPAENPRFVKLHRRFPTVAYLRRHARRHVPSFA
Ga0182038_1120855913300016445SoilMHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRF
Ga0187777_1067307723300017974Tropical PeatlandMDDRTALVRPHANEHTPADNPRFLKLHRRFPTVAYL
Ga0066662_1158331823300018468Grasslands SoilMHDMTALGRPDAKPYAPADNPAFIGLHRRFPSIAYLRRRARRR
Ga0190267_1021596213300019767SoilMHDTTALARPASPYNPADNPRFSALHRHFPTVAYLRRHARRQLPNFA
Ga0210401_1061935323300020583SoilMHDMTALGRPDAKPYAPADNPDFIGLHRRFPSIAYL
Ga0210393_1141526423300021401SoilMHDVTALGHPDAKPYTPADNPAFIELHRRFPTIAYLRQRARRRLPRFAFEY
Ga0210392_1100378423300021475SoilMQDTTALVPPAAKDYVPADNPRFVKLHRRFPTVLYLRRHARRHVPRFA
Ga0210410_1126361813300021479SoilMHDVTALGHPDAKPYTPADNPAFIELHRRFPTIAYLRQRARRRLPRFAF
Ga0126371_1089877823300021560Tropical Forest SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRHV
Ga0207646_1189786123300025922Corn, Switchgrass And Miscanthus RhizosphereMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFE
Ga0207689_1153125423300025942Miscanthus RhizosphereMHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRH
Ga0207677_1123508213300026023Miscanthus RhizosphereMHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRHARRQVPRFA
Ga0209237_113554113300026297Grasslands SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARR
Ga0209055_124286113300026309SoilMHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHARSPVP
Ga0209239_115721023300026310Grasslands SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRR
Ga0209577_1016206113300026552SoilMHDTTALSRPAAKDYTPADNPRFAKLHRRFPTVADLRRHARRH
Ga0209590_1000884873300027882Vadose Zone SoilMHDTTALTRPAAATKDYTPADNPGFVKLHRRFPAVAYLRRHARRHVPRFAFEYM
Ga0209488_1090492413300027903Vadose Zone SoilMHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHARRHVPSF
Ga0207428_1016721023300027907Populus RhizosphereMHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRY
Ga0307285_1018014913300028712SoilMHDTTALARPANPYNPADNPRFSKLHRRFPTVAYLRRHARRQVPNFAFE
Ga0307317_1019226423300028720SoilMHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHARR
Ga0307317_1029691323300028720SoilMHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVPKFAF
Ga0307299_1026834213300028793SoilMHDTTAVTRPNVTIYTPADNPRFPNLHRRFPTVAYLRRHARRKLPHFAFEYCD
Ga0308197_1016348113300031093SoilMHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHACRHV
Ga0307497_1017560923300031226SoilMHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRR
Ga0170824_12837676413300031231Forest SoilMHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRRHARRQVP
Ga0170819_1609755913300031469Forest SoilMHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRRHA
Ga0318515_1077717123300031572SoilMQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEY
Ga0318574_1022350213300031680SoilMHDTTALARSAANDYTPADNPRFVKLHRRFPTVAYLRRHARRQVPSFAFEYM
Ga0318572_1068488413300031681SoilMQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLRQHARRHVPSFAFEY
Ga0318560_1031641613300031682SoilMQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVP
Ga0307469_1133912513300031720Hardwood Forest SoilQETTAVVEPAAKIYTPADNARFAQLHRRFPTVAYLRRHARRKLPHFAFE
Ga0318546_1037227923300031771SoilMHDTTALARSAGHAYTPADNSRFAGLHRRFPTTAYLRRHAPRHGPR
Ga0318552_1009830513300031782SoilMHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAY
Ga0318529_1033677723300031792SoilMHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRFAFEYMD
Ga0318548_1041225823300031793SoilMDDRTALVRPVANDYTPTDNPRFAGLHRRFPTIAYLRRHARRHLPRFAFE
Ga0318550_1022872213300031797SoilMHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAYLRRHAS
Ga0318567_1006242913300031821SoilMHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAYL
Ga0318499_1002523733300031832SoilMQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRH
Ga0306925_1035155513300031890SoilMHDTTALDRSAGTAYTPAENPRFPGLHRRFPTTAYLRRHA
Ga0306925_1139938613300031890SoilMAGKKALMHDTTALAPPTVADYTPADNPRFVRLHRRFPTVAYLRRHA
Ga0306925_1219051123300031890SoilMDDRTALVRPVANDYTPTDNPRFAGLHRRFPTIAYLRRHARRHL
Ga0318536_1052485213300031893SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNVPSFAFEYMD
Ga0310912_1127043313300031941SoilMDDRTALVRPAANDYTPADNPRFAGLHRRFPTIAYLRRHARR
Ga0306926_1274070913300031954SoilMHDTTALAPPTVADYTPADNPRFVRLHRRFPTVAYLRRHARR
Ga0306922_1202942713300032001SoilMAGKKALIHDTTALATPTVADYTPADNPRFVRLHRRFPTVAYLRRHARRHVPRFAF
Ga0318556_1008725733300032043SoilMHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYP
Ga0318570_1036872413300032054SoilMQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLR
Ga0318504_1046866423300032063SoilMHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAY
Ga0306924_10008813133300032076SoilMHDTTALSRPTAKDYTPADNPRFTKLHRRFPTVADLR
Ga0307471_10106739513300032180Hardwood Forest SoilMHDTTALVRSAASDYTPADNPRFLKLHRRFPTIAYLRQHARSHVPS
Ga0307472_10244381723300032205Hardwood Forest SoilMHDTTALARPNARIYLPADNPRFAALHRRFPTVAYLRRQARRKLPHFAFEYCD
Ga0326723_0182570_2_1333300034090Peat SoilMHDTTAVTKPNVKVYTPADNPRYVKLHRRFPTVPYLRRHARRNL
Ga0364929_0073313_914_10573300034149SedimentMDDTTALPRAAAGDYTPADNPRFIKLHRRFPTIDYLRRQARRHVPSFA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.