NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086876

Metagenome / Metatranscriptome Family F086876

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086876
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 47 residues
Representative Sequence VVYAMSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTFDWRPA
Number of Associated Samples 102
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 89.09 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.818 % of family members)
Environment Ontology (ENVO) Unclassified
(29.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.364 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.79%    β-sheet: 19.74%    Coil/Unstructured: 64.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF02230Abhydrolase_2 35.45
PF00005ABC_tran 22.73
PF00221Lyase_aromatic 11.82
PF00583Acetyltransf_1 7.27
PF02621VitK2_biosynth 5.45
PF00459Inositol_P 2.73
PF09084NMT1 1.82
PF00291PALP 1.82
PF13458Peripla_BP_6 1.82
PF00561Abhydrolase_1 1.82
PF04679DNA_ligase_A_C 1.82
PF00881Nitroreductase 0.91
PF02738MoCoBD_1 0.91
PF13673Acetyltransf_10 0.91
PF027373HCDH_N 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 11.82
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 5.45
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.82
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 1.82
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.82
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.91
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.91
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.91
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.91
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.91
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.91
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.18 %
UnclassifiedrootN/A21.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004024|Ga0055436_10002964All Organisms → cellular organisms → Bacteria3146Open in IMG/M
3300004114|Ga0062593_102284703All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300004479|Ga0062595_101741960All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005178|Ga0066688_10148870All Organisms → cellular organisms → Bacteria → Proteobacteria1465Open in IMG/M
3300005186|Ga0066676_10080178All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300005186|Ga0066676_10109422All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300005406|Ga0070703_10545575All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300005439|Ga0070711_100101617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2093Open in IMG/M
3300005445|Ga0070708_101260485All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005446|Ga0066686_10266134All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300005471|Ga0070698_102212595Not Available503Open in IMG/M
3300005526|Ga0073909_10152741All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005536|Ga0070697_100447625All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005544|Ga0070686_100549958All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005545|Ga0070695_100482971All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300005549|Ga0070704_100027910All Organisms → cellular organisms → Bacteria3749Open in IMG/M
3300005554|Ga0066661_10728993All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300005554|Ga0066661_10888984All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300005617|Ga0068859_100380121All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300005719|Ga0068861_102272025All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005873|Ga0075287_1061068All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006796|Ga0066665_11393424All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006844|Ga0075428_102088261All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300006852|Ga0075433_11765283All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300006904|Ga0075424_101882567All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009012|Ga0066710_101700743All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300009038|Ga0099829_10818962Not Available773Open in IMG/M
3300009088|Ga0099830_10823923All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium766Open in IMG/M
3300009090|Ga0099827_11303118All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium632Open in IMG/M
3300009101|Ga0105247_11292754All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300009162|Ga0075423_13089456All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300009553|Ga0105249_10996528All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300009553|Ga0105249_12424789Not Available597Open in IMG/M
3300009678|Ga0105252_10553476All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria531Open in IMG/M
3300009792|Ga0126374_11786136All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010043|Ga0126380_10539495All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300010048|Ga0126373_11201746All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300010358|Ga0126370_11975441Not Available569Open in IMG/M
3300010359|Ga0126376_11450945Not Available713Open in IMG/M
3300010359|Ga0126376_12379439All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010362|Ga0126377_10063816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3253Open in IMG/M
3300010391|Ga0136847_13410978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1058Open in IMG/M
3300010397|Ga0134124_11341480All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300010398|Ga0126383_13504667Not Available512Open in IMG/M
3300012035|Ga0137445_1076982Not Available670Open in IMG/M
3300012096|Ga0137389_10111021All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300012201|Ga0137365_10017729All Organisms → cellular organisms → Bacteria → Proteobacteria5560Open in IMG/M
3300012351|Ga0137386_10871666All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012353|Ga0137367_11170533All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300012362|Ga0137361_10471797All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300012363|Ga0137390_11285120All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium678Open in IMG/M
3300012922|Ga0137394_10482671All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300012922|Ga0137394_10503043All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300012971|Ga0126369_11580532All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300014873|Ga0180066_1106135All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300014883|Ga0180086_1167881All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300015264|Ga0137403_11268475All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300015372|Ga0132256_102752914All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300017999|Ga0187767_10368042Not Available510Open in IMG/M
3300018027|Ga0184605_10448074Not Available569Open in IMG/M
3300018029|Ga0187787_10183607All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300018031|Ga0184634_10082797All Organisms → cellular organisms → Bacteria → Proteobacteria1380Open in IMG/M
3300018079|Ga0184627_10628237Not Available536Open in IMG/M
3300018429|Ga0190272_10526641All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300018431|Ga0066655_10088964All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300019487|Ga0187893_10106790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2439Open in IMG/M
3300019882|Ga0193713_1174505Not Available563Open in IMG/M
3300019886|Ga0193727_1081699All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300020150|Ga0187768_1004808All Organisms → cellular organisms → Bacteria → Proteobacteria2716Open in IMG/M
3300021090|Ga0210377_10338621Not Available910Open in IMG/M
3300021333|Ga0210324_1115617Not Available602Open in IMG/M
3300025164|Ga0209521_10365933All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300025165|Ga0209108_10197015All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300025289|Ga0209002_10330415All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300025905|Ga0207685_10354610All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300025912|Ga0207707_10522540All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300025917|Ga0207660_10458554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1031Open in IMG/M
3300025934|Ga0207686_11803400Not Available506Open in IMG/M
3300025938|Ga0207704_10513297Not Available968Open in IMG/M
3300025961|Ga0207712_11657785All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300025999|Ga0208417_101100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1009Open in IMG/M
3300026309|Ga0209055_1299061Not Available506Open in IMG/M
3300026351|Ga0257170_1039618Not Available646Open in IMG/M
3300026508|Ga0257161_1085877All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium651Open in IMG/M
3300027646|Ga0209466_1015481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1603Open in IMG/M
3300027875|Ga0209283_10426534Not Available862Open in IMG/M
3300027909|Ga0209382_10243399All Organisms → cellular organisms → Bacteria → Acidobacteria2045Open in IMG/M
3300027909|Ga0209382_10789152All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300028587|Ga0247828_10857541All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300028792|Ga0307504_10255438Not Available643Open in IMG/M
3300028807|Ga0307305_10195761All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300028814|Ga0307302_10437499All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria648Open in IMG/M
3300030006|Ga0299907_10146530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1951Open in IMG/M
3300030619|Ga0268386_10005978All Organisms → cellular organisms → Bacteria → Proteobacteria9134Open in IMG/M
3300031229|Ga0299913_10155441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2257Open in IMG/M
3300031573|Ga0310915_10357825All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300031720|Ga0307469_11103148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria746Open in IMG/M
3300031740|Ga0307468_100601631All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300031740|Ga0307468_101468453All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300031768|Ga0318509_10289859All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031771|Ga0318546_10169816All Organisms → cellular organisms → Bacteria → Proteobacteria1478Open in IMG/M
3300031949|Ga0214473_11484590All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300032143|Ga0315292_10172890Not Available1753Open in IMG/M
3300032174|Ga0307470_10559671Not Available847Open in IMG/M
3300032893|Ga0335069_11149670Not Available853Open in IMG/M
3300033433|Ga0326726_10095787All Organisms → cellular organisms → Bacteria → Proteobacteria2649Open in IMG/M
3300033433|Ga0326726_11283402All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium712Open in IMG/M
3300033807|Ga0314866_028763All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300033814|Ga0364930_0152443Not Available788Open in IMG/M
3300034165|Ga0364942_0051135Not Available1326Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.73%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.82%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.82%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.91%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025999Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055436_1000296453300004024Natural And Restored WetlandsNLLKSVIYAMSPQAITDVWVHGRHVVKDRRLATLDQDALMARVAALTRGWIPA*
Ga0062593_10228470313300004114SoilLLKSVVYAMSPQAVTDAWVHGRAAVRGGRLVTLDQDGLLARVRALTHDWRVA*
Ga0062595_10174196023300004479SoilNVVYAMSHQAVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA*
Ga0066688_1014887013300005178SoilPQAVTDVWVHGRPIVQDGRLTTLDQDDLMVRVAALTRGWTSA*
Ga0066676_1008017813300005186SoilVYAMSPQAVTDVWVHGHRVVTGQRLATLDQDQLMERVRALTRDWTPA*
Ga0066676_1010942213300005186SoilLLKNVVYAMSHQAVTDVWVHGRQVVRSQRLTTLDQDALMERVRALTRDWTPA*
Ga0070703_1054557513300005406Corn, Switchgrass And Miscanthus RhizosphereKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA*
Ga0070711_10010161743300005439Corn, Switchgrass And Miscanthus RhizosphereYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA*
Ga0070708_10126048513300005445Corn, Switchgrass And Miscanthus RhizosphereFAMSPQAVTDVWVHGQPVIRGGRLATLDQDDLLARVRALTREWRVA*
Ga0066686_1026613413300005446SoilNLLKNVVYAMSHQAVTDVWVHGRQVVRSQRLTTLDQHALMERVRALTRDWTPA*
Ga0070698_10221259523300005471Corn, Switchgrass And Miscanthus RhizosphereMSHQAVTDAWVHGRHVLRDQRLTTVDQAALLERVRALTKGWPAG*
Ga0073909_1015274133300005526Surface SoilPSLHPPTSLLKSVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQAELMERVRALTRDWRLA
Ga0070697_10044762533300005536Corn, Switchgrass And Miscanthus RhizosphereNLLKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA*
Ga0070686_10054995833300005544Switchgrass RhizosphereNVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG*
Ga0070695_10048297113300005545Corn, Switchgrass And Miscanthus RhizosphereMSHQAVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA*
Ga0070704_10002791013300005549Corn, Switchgrass And Miscanthus RhizosphereTNLLKNVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQAELMERVRVLTRDWRVA*
Ga0066661_1072899323300005554SoilMSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVAALTRGWSAA*
Ga0066661_1088898423300005554SoilMSPQAVTDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA*
Ga0068859_10038012113300005617Switchgrass RhizosphereLLKSVVYAMSHQAVTDVWVHGRAVVRGQRLASLDQAALMERVRALTRDWRLA*
Ga0068861_10227202523300005719Switchgrass RhizospherePPTNLLKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA*
Ga0075287_106106823300005873Rice Paddy SoilMSHQAVTDVWVHGRRVVEHQRLALVDQADLLARVRALTRGWTLA*
Ga0066665_1139342423300006796SoilDFFYAMSAQAVSDVWVHGRPVVRGQRLVALDQDALMERVRALTREWKPA*
Ga0075428_10208826123300006844Populus RhizosphereSVVYAMSPQAVTDVWVHGRPVVRGQRLATMEQAALLERVQRLTRDWRP*
Ga0075433_1176528313300006852Populus RhizospherePQAITDVWVHGRQVVAKQRLTTLDQETLMERVRRLTHGWTSA*
Ga0075424_10188256723300006904Populus RhizospherePTRLLKNVVYAMSPQAVTDVWIRGRQVVRSQRLTTLDQDGLMDRVRALTRDWALA*
Ga0066710_10170074323300009012Grasslands SoilVVYAMSHQAVADVWVHGRQVVRSQRLTTLDQGALMERVRALTRDWTPA
Ga0099829_1081896223300009038Vadose Zone SoilTDVWVHGRRIVQDRRLATLDQEDLMARVAALTRGWTAA*
Ga0099830_1082392313300009088Vadose Zone SoilQAVTDVWVHGRRIVQDRRLATLDQETLMARVAALTRGWSTG*
Ga0099827_1130311813300009090Vadose Zone SoilAMSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVATLTRGWSAA*
Ga0105247_1129275423300009101Switchgrass RhizosphereVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG*
Ga0075423_1308945613300009162Populus RhizosphereITDVWVHGSPVVKAQKLATIDQEALMARVRTLTHDWVPA*
Ga0105249_1099652813300009553Switchgrass RhizosphereTMSHQAVTDVWVHGRPIVRGQRLATIEQAELMERVRALTRDWRVA*
Ga0105249_1242478913300009553Switchgrass RhizosphereAMSARAVTDAWVHGRRVVEDRRLVTVDQASLMERVRALTAGWTA*
Ga0105252_1055347623300009678SoilVYAMSPQAVSDVWVQGQPVVRGGRLATLDQDALLARVRALTHDWRVA*
Ga0126374_1178613613300009792Tropical Forest SoilQAVTDVWVHGRQVVRSQRLTTLDQDGLKERVRRLTRDWALA*
Ga0126380_1053949523300010043Tropical Forest SoilVWVRGRQVVRGQRLTTLDQDGLMERVRALTRDWVVV*
Ga0126373_1120174623300010048Tropical Forest SoilMSPQAVTDVWVHGRQVVRGERLTGVDQDALMERVRALTRDWRLA*
Ga0126370_1197544123300010358Tropical Forest SoilSPQAITDVWVQSRRVVAQQRLTTLDQNELMERVRRLTRAWKAV*
Ga0126376_1145094513300010359Tropical Forest SoilITDVWVHGRQVVSGQKLVTLDQEGLMERVQTLTRNWTRQ*
Ga0126376_1237943923300010359Tropical Forest SoilVVYAMSPQAITDVWVHGRRVVAKQRLATLDQETLMERVRRLTHDWAPA*
Ga0126377_1006381673300010362Tropical Forest SoilLKSVVYAMSHQAVTDVWVHGRHVVAAQHLVTLDQEDLLARVRALTQDWRVA*
Ga0136847_1341097813300010391Freshwater SedimentMSPQAITDVWVHGRQVVKDQRLTLLDQDSLMERVRALTRGWTAG*
Ga0134124_1134148023300010397Terrestrial SoilDVWVHGRPVVRGQRLATLDQAHLTERVRALTHDWGLA*
Ga0126383_1350466713300010398Tropical Forest SoilPPSSLLKNVVYAMSPQAITDVWVHGRQVVAKQRLSTLDQETLMERVRRLTHGWTAA*
Ga0137445_107698213300012035SoilVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTFDWRPA*
Ga0137389_1011102113300012096Vadose Zone SoilPSLHPRSHLLKNVVYAMSHQAVTDVWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA
Ga0137365_1001772993300012201Vadose Zone SoilYAMSPQAVTDVWVHGRPIVEDGRLTTLDQDDLMVRVAALTRGWTSA*
Ga0137386_1087166613300012351Vadose Zone SoilHQAVSDVWVHGRQVVRNQRLATLGREALMERVSRLTRDWTLA*
Ga0137367_1117053313300012353Vadose Zone SoilTDVWVHGSQVVKAQKLATLDQETLMERVRKLTDGWAPA*
Ga0137361_1047179723300012362Vadose Zone SoilAMSHQAVTDVWVHGRQVVRSQRLTTLDQDALMERVRTLTRDWTPA*
Ga0137390_1128512023300012363Vadose Zone SoilAMSPQAVTDVWVHGRRIVQDRRLATLDQEDLMARVAALTRGWTAA*
Ga0137394_1048267113300012922Vadose Zone SoilMSPQAITDVWVHGRQVVKGQKLATLDQEALMERVRKLTDGGAPA*
Ga0137394_1050304333300012922Vadose Zone SoilVWVHGRQVVRGQRLATMDQAGLMERVRAVTADWRPA*
Ga0126369_1158053213300012971Tropical Forest SoilVVYSMSPQAVTDVWVRGRPVVRSQRLTTLDQDELMERVRRLTRDWALA*
Ga0180066_110613513300014873SoilTDVWVHGRQVVKGQRLTTLDQDSLMERVRALTRGWTAA*
Ga0180086_116788113300014883SoilVVYAMSPQAITDVWVHGRQVVKGQKLATLDQEVLMERVRKLSGGWAPA*
Ga0137403_1126847513300015264Vadose Zone SoilVVYAMSPQAITDVWVHGSPVVKAQKLATLDQEALMERVRTLTHGWAPA*
Ga0132256_10275291423300015372Arabidopsis RhizosphereLHPPTKLLKNVVYAMSPQAVTDVWVRGRQVVRSQRLTMLDQDGLMERVRALTRDWSLA*
Ga0187767_1036804223300017999Tropical PeatlandVVYAMSPQAITDVWVEGRRVVERQRLTTLDQEELLERVRQLTRDWRPDVGC
Ga0184605_1044807423300018027Groundwater SedimentHLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA
Ga0187787_1018360713300018029Tropical PeatlandYAMSPQAISDVWVHGRPVVLGQRLATIDQSALLARVRALTADWRPA
Ga0184634_1008279713300018031Groundwater SedimentAMSPQAVTDVWVHGRAVVRDQRLATVDQAALMERVRALTFDWRPA
Ga0184627_1062823723300018079Groundwater SedimentAVTDVWVHGRPVVRDQRLATVDQAALMERVRALTFDWRPA
Ga0190272_1052664113300018429SoilMSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTVDWRPA
Ga0066655_1008896413300018431Grasslands SoilTDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA
Ga0187893_1010679013300019487Microbial Mat On RocksNLLKNVVYAMSHQAVTDVWVDGARVVKERRLATLDQTALLEQVRSLTRDWTVA
Ga0193713_117450513300019882SoilMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA
Ga0193727_108169933300019886SoilLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA
Ga0187768_100480843300020150Tropical PeatlandAVTDVWVHGRAVVRDRRLASVDQAALMARVRALTADWRPA
Ga0210377_1033862113300021090Groundwater SedimentLKNVVYAMSHQAVTDVWVEGRQVVKNQRLTLLDQPDLMERVRRLTQEWKPA
Ga0210324_111561723300021333EstuarineTDVWVHGRHVVRAQKLATLDQDTLIERVRELTRGWAPA
Ga0209521_1036593313300025164SoilLHPPTSLLKSVVYAMSPQAITDVWVHGRHVVKDQRVATVDQGALMERVRTLTRGWAPA
Ga0209108_1019701533300025165SoilGHPSLHPPTSLLKSVVYAMSPQAITDVWVHGRHVVKDQRLTTVDQGALMERVRTLTRGWAPA
Ga0209002_1033041533300025289SoilLHPPTDLLKNVVYSMSPQAITDVWVHGHQVVRNQRLTMLDQAGLMERVRALTRDWKRP
Ga0207685_1035461023300025905Corn, Switchgrass And Miscanthus RhizosphereSLHPPTNLMKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA
Ga0207707_1052254033300025912Corn RhizosphereQTVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA
Ga0207660_1045855413300025917Corn RhizosphereQAVTDAWVHGRAAVRGGRLVTLDQDGLLARVRALTHDWRVA
Ga0207686_1180340013300025934Miscanthus RhizosphereMKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA
Ga0207704_1051329713300025938Miscanthus RhizosphereLLKNVVYAMSHQTVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA
Ga0207712_1165778523300025961Switchgrass RhizosphereQAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG
Ga0208417_10110033300025999Rice Paddy SoilAVTDVWVHGRPVVRAQRLATLEQAALMERVRALTAGWRPA
Ga0209055_129906113300026309SoilVTDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA
Ga0257170_103961813300026351SoilVWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA
Ga0257161_108587723300026508SoilKSVVYAMSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVTALTRGWSAA
Ga0209466_101548113300027646Tropical Forest SoilVWVHGQQVVAKQRLATLDQETLMERVRRLTHGWTAA
Ga0209283_1042653423300027875Vadose Zone SoilQAVTDVWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA
Ga0209382_1024339913300027909Populus RhizosphereSPQAITDVWVHGHPVVRGGRLATLDQNDLLARVRALTGDWRVA
Ga0209382_1078915213300027909Populus RhizosphereRAALVKSVVYAMSPQAVTDVWVHGRPVVRGQRLATMEQAALLERVQRLTRDWRP
Ga0247828_1085754113300028587SoilRWPRTHLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA
Ga0307504_1025543813300028792SoilAMSPQAVTDVWVHGRPVVRERRLATVDQAALMERVRALTFDWRPA
Ga0307305_1019576133300028807SoilSLHPRTHLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRAVTADWRPA
Ga0307302_1043749913300028814SoilAVTDVWVHGQLVVRSGRLATLDQDDLLARVRALTREWRVA
Ga0299907_1014653013300030006SoilLKNVVYAMSPQAVTDVWVHGRPVVRGQRLATMDQGGLMERVRALTADWRPA
Ga0268386_10005978103300030619SoilAMSHQAVTDVWVHGRPVVRGQRLATLDQAGLMERVRALTTDWQPA
Ga0299913_1015544143300031229SoilQAVTDVWVHGRPVVRGQRLATMDQGGLMERVRALTADWRPA
Ga0310915_1035782523300031573SoilYAMSPQAITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA
Ga0307469_1110314823300031720Hardwood Forest SoilSPQAVTDVWVHGQQVIRGGRLATLDQDDLLARVRGLTHDWRVA
Ga0307468_10060163113300031740Hardwood Forest SoilVVYAMSPQAVTDVWVHGAQVVKAQKLATIDQEALMERVRTLTHGWAPA
Ga0307468_10146845313300031740Hardwood Forest SoilEHPSLHPQTSLLKSVVYALSHQAVTDVWVHGRPVVRGQRLATLEQAELMERVRALTRDWRLA
Ga0318509_1028985913300031768SoilHPPSRLLKNVVYAMSPQAITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA
Ga0318546_1016981613300031771SoilITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA
Ga0214473_1148459013300031949SoilPTSLLKSIVYAMSPQAVTDVWVHGRPVVRGQRLATLDQAELMERVRALTCDWRLA
Ga0315292_1017289043300032143SedimentPQAITDVWVHGRQVVKEQKLATLDQEALMERVGKLTRAWTPA
Ga0307470_1055967123300032174Hardwood Forest SoilTDVWVHGTPVVKAQKLATLDQEALMERVRTLTHGWVPA
Ga0335069_1114967013300032893SoilVVYAMSPQAITDVWVHGRQVVKGQKLATLDQGALMERVQKLTGSWAPV
Ga0326726_1009578713300033433Peat SoilEHPSLHPRTHLLKSVVYAMSPQAVTDVWVHGRPVVRGQRLATLDQAALMARVRALTADWRPA
Ga0326726_1128340213300033433Peat SoilMSPQAITDVWVHGRQVVKGQKLTTLDQEALMDRVRKLTSGWAPA
Ga0314866_028763_688_8463300033807PeatlandPLKSVVYAMSPQAITDVWVHGRRVVEAQRLATMDQDALMERVRTLTKGWSPA
Ga0364930_0152443_2_1213300033814SedimentITDVWVHGRQVVKDQRLTMLDQDSLMERVRALTRGWTAA
Ga0364942_0051135_3_1853300034165SedimentPSLHPPTDLLKNVVYAMSPQAITDVWVHGHQVVRNQRLTMLDQAGLMERVRALTRDWKRP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.