


| Basic Information | |
|---|---|
| Family ID | F086852 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.27 % |
| % of genes near scaffold ends (potentially truncated) | 87.27 % |
| % of genes from short scaffolds (< 2000 bps) | 60.91 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.545 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (51.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF09718 | Tape_meas_lam_C | 12.73 |
| PF05100 | Phage_tail_L | 5.45 |
| PF05939 | Phage_min_tail | 4.55 |
| PF08809 | DUF1799 | 1.82 |
| PF05876 | GpA_ATPase | 0.91 |
| PF14464 | Prok-JAB | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 5.45 |
| COG4718 | Phage tail protein | Mobilome: prophages, transposons [X] | 4.55 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.45 % |
| Unclassified | root | N/A | 44.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_108748636 | Not Available | 501 | Open in IMG/M |
| 3300002835|B570J40625_100159304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2552 | Open in IMG/M |
| 3300005805|Ga0079957_1251002 | Not Available | 821 | Open in IMG/M |
| 3300006026|Ga0075478_10025490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1981 | Open in IMG/M |
| 3300006802|Ga0070749_10016242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4742 | Open in IMG/M |
| 3300006810|Ga0070754_10027673 | All Organisms → Viruses | 3208 | Open in IMG/M |
| 3300006868|Ga0075481_10135027 | Not Available | 903 | Open in IMG/M |
| 3300007346|Ga0070753_1015299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3508 | Open in IMG/M |
| 3300007538|Ga0099851_1052247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1603 | Open in IMG/M |
| 3300007539|Ga0099849_1003021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28 | 7766 | Open in IMG/M |
| 3300007539|Ga0099849_1006941 | Not Available | 5136 | Open in IMG/M |
| 3300007539|Ga0099849_1021493 | Not Available | 2805 | Open in IMG/M |
| 3300007539|Ga0099849_1258230 | Not Available | 639 | Open in IMG/M |
| 3300007539|Ga0099849_1364726 | Not Available | 512 | Open in IMG/M |
| 3300007640|Ga0070751_1284901 | Not Available | 619 | Open in IMG/M |
| 3300007960|Ga0099850_1029427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2404 | Open in IMG/M |
| 3300007960|Ga0099850_1297933 | Not Available | 612 | Open in IMG/M |
| 3300007960|Ga0099850_1330635 | Not Available | 574 | Open in IMG/M |
| 3300008266|Ga0114363_1005465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14459 | Open in IMG/M |
| 3300008339|Ga0114878_1040493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2032 | Open in IMG/M |
| 3300009593|Ga0115011_10848115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300009790|Ga0115012_10283927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1241 | Open in IMG/M |
| 3300010296|Ga0129348_1203649 | Not Available | 673 | Open in IMG/M |
| 3300010299|Ga0129342_1015124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3204 | Open in IMG/M |
| 3300010299|Ga0129342_1081954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1227 | Open in IMG/M |
| 3300010299|Ga0129342_1218402 | Not Available | 672 | Open in IMG/M |
| 3300010300|Ga0129351_1051135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1689 | Open in IMG/M |
| 3300010300|Ga0129351_1109055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1108 | Open in IMG/M |
| 3300010300|Ga0129351_1157664 | Not Available | 894 | Open in IMG/M |
| 3300010300|Ga0129351_1203919 | Not Available | 767 | Open in IMG/M |
| 3300010300|Ga0129351_1391552 | Not Available | 519 | Open in IMG/M |
| 3300010354|Ga0129333_10004306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13317 | Open in IMG/M |
| 3300010354|Ga0129333_10151044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2131 | Open in IMG/M |
| 3300010354|Ga0129333_11256148 | Not Available | 613 | Open in IMG/M |
| 3300010368|Ga0129324_10089611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1340 | Open in IMG/M |
| 3300010370|Ga0129336_10099838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1702 | Open in IMG/M |
| 3300010370|Ga0129336_10492763 | Not Available | 661 | Open in IMG/M |
| 3300013087|Ga0163212_1124184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 822 | Open in IMG/M |
| 3300013087|Ga0163212_1258519 | Not Available | 540 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10161389 | Not Available | 1802 | Open in IMG/M |
| 3300013372|Ga0177922_10427416 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
| 3300013372|Ga0177922_11080639 | Not Available | 527 | Open in IMG/M |
| 3300017701|Ga0181364_1018268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300017762|Ga0181422_1020460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2172 | Open in IMG/M |
| 3300017771|Ga0181425_1031483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1749 | Open in IMG/M |
| 3300017777|Ga0181357_1173246 | Not Available | 783 | Open in IMG/M |
| 3300017781|Ga0181423_1369379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 520 | Open in IMG/M |
| 3300017784|Ga0181348_1027513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2405 | Open in IMG/M |
| 3300017784|Ga0181348_1176199 | Not Available | 783 | Open in IMG/M |
| 3300017967|Ga0181590_10189106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1553 | Open in IMG/M |
| 3300017971|Ga0180438_11195340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 548 | Open in IMG/M |
| 3300018424|Ga0181591_11036406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300020083|Ga0194111_10078672 | Not Available | 2733 | Open in IMG/M |
| 3300020083|Ga0194111_10438812 | Not Available | 854 | Open in IMG/M |
| 3300020183|Ga0194115_10042525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2991 | Open in IMG/M |
| 3300020183|Ga0194115_10054281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2504 | Open in IMG/M |
| 3300020183|Ga0194115_10190874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1021 | Open in IMG/M |
| 3300020190|Ga0194118_10424971 | Not Available | 663 | Open in IMG/M |
| 3300020197|Ga0194128_10057962 | Not Available | 2732 | Open in IMG/M |
| 3300020198|Ga0194120_10275068 | Not Available | 863 | Open in IMG/M |
| 3300020204|Ga0194116_10300815 | Not Available | 844 | Open in IMG/M |
| 3300020220|Ga0194119_10085342 | Not Available | 2577 | Open in IMG/M |
| 3300020395|Ga0211705_10146387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 863 | Open in IMG/M |
| 3300020436|Ga0211708_10113035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1068 | Open in IMG/M |
| 3300020498|Ga0208050_1001670 | Not Available | 3084 | Open in IMG/M |
| 3300020498|Ga0208050_1009695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1097 | Open in IMG/M |
| 3300020551|Ga0208360_1011172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1273 | Open in IMG/M |
| 3300021376|Ga0194130_10009273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28 | 10200 | Open in IMG/M |
| 3300021376|Ga0194130_10066771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2473 | Open in IMG/M |
| 3300021424|Ga0194117_10049650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2437 | Open in IMG/M |
| 3300021962|Ga0222713_10505138 | Not Available | 722 | Open in IMG/M |
| 3300021963|Ga0222712_10021369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5369 | Open in IMG/M |
| 3300021964|Ga0222719_10108090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2023 | Open in IMG/M |
| 3300022074|Ga0224906_1032077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1788 | Open in IMG/M |
| 3300022190|Ga0181354_1136953 | Not Available | 776 | Open in IMG/M |
| 3300022198|Ga0196905_1015415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Neritesvirus → Neritesvirus scam8 | 2458 | Open in IMG/M |
| 3300022198|Ga0196905_1079143 | Not Available | 897 | Open in IMG/M |
| 3300022200|Ga0196901_1224152 | Not Available | 594 | Open in IMG/M |
| 3300023116|Ga0255751_10054792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2710 | Open in IMG/M |
| 3300025137|Ga0209336_10061679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1133 | Open in IMG/M |
| 3300025646|Ga0208161_1062940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1132 | Open in IMG/M |
| 3300025653|Ga0208428_1107738 | Not Available | 779 | Open in IMG/M |
| 3300025655|Ga0208795_1097666 | Not Available | 791 | Open in IMG/M |
| 3300025671|Ga0208898_1030055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2231 | Open in IMG/M |
| 3300025674|Ga0208162_1011447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 3690 | Open in IMG/M |
| 3300025674|Ga0208162_1018541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2726 | Open in IMG/M |
| 3300025687|Ga0208019_1023086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2404 | Open in IMG/M |
| 3300025815|Ga0208785_1093336 | Not Available | 753 | Open in IMG/M |
| 3300025853|Ga0208645_1100312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1201 | Open in IMG/M |
| 3300027785|Ga0209246_10006283 | Not Available | 4400 | Open in IMG/M |
| 3300027798|Ga0209353_10020937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3079 | Open in IMG/M |
| 3300027798|Ga0209353_10030929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2491 | Open in IMG/M |
| 3300027798|Ga0209353_10195268 | Not Available | 888 | Open in IMG/M |
| 3300027917|Ga0209536_101957142 | Not Available | 703 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10200973 | Not Available | 876 | Open in IMG/M |
| 3300029930|Ga0119944_1001408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4280 | Open in IMG/M |
| 3300029930|Ga0119944_1001472 | All Organisms → Viruses | 4162 | Open in IMG/M |
| 3300029930|Ga0119944_1002387 | Not Available | 3254 | Open in IMG/M |
| 3300029930|Ga0119944_1039916 | Not Available | 583 | Open in IMG/M |
| 3300029933|Ga0119945_1002134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Acionnavirus → unclassified Acionnavirus → Synechococcus phage S-CAM8 | 2942 | Open in IMG/M |
| 3300029933|Ga0119945_1002462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 2722 | Open in IMG/M |
| 3300031539|Ga0307380_10763529 | Not Available | 804 | Open in IMG/M |
| 3300031565|Ga0307379_10217011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1944 | Open in IMG/M |
| 3300032047|Ga0315330_10119257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1739 | Open in IMG/M |
| 3300032047|Ga0315330_10215581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS5 group | 1237 | Open in IMG/M |
| 3300033979|Ga0334978_0402024 | Not Available | 645 | Open in IMG/M |
| 3300033981|Ga0334982_0031956 | Not Available | 2999 | Open in IMG/M |
| 3300034112|Ga0335066_0041324 | Not Available | 3117 | Open in IMG/M |
| 3300034118|Ga0335053_0320289 | Not Available | 966 | Open in IMG/M |
| 3300034418|Ga0348337_180963 | Not Available | 551 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 13.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.73% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.91% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1087486362 | 3300002408 | Freshwater | PSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNSKRK* |
| B570J40625_1001593042 | 3300002835 | Freshwater | GLNYPSLEWLCKLYSVKDPVAVFEGVQVMEMAALSVLNASRK* |
| Ga0079957_12510022 | 3300005805 | Lake | LTGLNYPSLEWLCKLYSAKDPVAIFEGIQVMEMAALAVLNASRK* |
| Ga0075478_100254901 | 3300006026 | Aqueous | WLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0070749_100162421 | 3300006802 | Aqueous | SMAGMTGLNYPSLEWLCKLYSAKDPVAIFEGIQVMEMAALAILNASRK* |
| Ga0070754_100276735 | 3300006810 | Aqueous | GLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNTKS* |
| Ga0075481_101350272 | 3300006868 | Aqueous | TGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0070753_10152991 | 3300007346 | Aqueous | NGAVGLHYPSLEWLCKLYAVKDPVAIFEGVQVMELTVLQTLNKDK* |
| Ga0099851_10522472 | 3300007538 | Aqueous | EWLCKLYSVKDPVAIFEGMQVMELAALAVLNANRK* |
| Ga0099849_10030217 | 3300007539 | Aqueous | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0099849_10069414 | 3300007539 | Aqueous | MAGLTGLNYPSLEWLCKLYSVKDPVALFEGVQVMETTALSVLNAERK* |
| Ga0099849_10214931 | 3300007539 | Aqueous | GLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0099849_12582302 | 3300007539 | Aqueous | HTSMAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0099849_13647262 | 3300007539 | Aqueous | YPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0070751_12849012 | 3300007640 | Aqueous | LNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNTKS* |
| Ga0099850_10294272 | 3300007960 | Aqueous | NYPSLEWLCKLYSVKDPVAIFEGVQVMEGAALAILNSKRAS* |
| Ga0099850_12979331 | 3300007960 | Aqueous | YPSLEWLCKLYSVKDPVAIFEGVQVMEAAALAALNSKRAS* |
| Ga0099850_13306351 | 3300007960 | Aqueous | LIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR* |
| Ga0114363_10054655 | 3300008266 | Freshwater, Plankton | VGGKLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNASRK* |
| Ga0114878_10404932 | 3300008339 | Freshwater Lake | EWLCKLYSVKDPVAIFEGVQVMEMAALAVLNASRK* |
| Ga0115011_108481152 | 3300009593 | Marine | MSGLTGLNYSSLPYLCKLYEVKDERLLFEGIQIMEMAALSCLHKKK* |
| Ga0115012_102839272 | 3300009790 | Marine | GMTGLNYSSLEYLCKLYEVKDPVVLFEGIQVMEMAALSCMNKKK* |
| Ga0129348_12036492 | 3300010296 | Freshwater To Marine Saline Gradient | EWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0129342_10151244 | 3300010299 | Freshwater To Marine Saline Gradient | SLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0129342_10819541 | 3300010299 | Freshwater To Marine Saline Gradient | LEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0129342_12184022 | 3300010299 | Freshwater To Marine Saline Gradient | YPSLEWLCKLYSVKDPVAIFEGIQVMESTVLVILNKKS* |
| Ga0129351_10511351 | 3300010300 | Freshwater To Marine Saline Gradient | SMAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK* |
| Ga0129351_11090552 | 3300010300 | Freshwater To Marine Saline Gradient | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNKQS* |
| Ga0129351_11576642 | 3300010300 | Freshwater To Marine Saline Gradient | LNYPSLEWLCKLYAVKDPVAIFEGVQIMELATLAIMNADRK* |
| Ga0129351_12039192 | 3300010300 | Freshwater To Marine Saline Gradient | LNYPSLEWLCKLYSVKDPVAIFEGVQVMELAALAVLNANRK* |
| Ga0129351_13915522 | 3300010300 | Freshwater To Marine Saline Gradient | YPSLEWLCKLYAVKDPVAIFEGVQVMELTVLQTLNRDK* |
| Ga0129333_100043066 | 3300010354 | Freshwater To Marine Saline Gradient | MAGMTGLIYQSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKRK* |
| Ga0129333_101510442 | 3300010354 | Freshwater To Marine Saline Gradient | GLTGLNYPSLEWLCKLYSVKDPVAVFEGVQVMEMAALSVLNASRK* |
| Ga0129333_112561482 | 3300010354 | Freshwater To Marine Saline Gradient | GLTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR* |
| Ga0129324_100896112 | 3300010368 | Freshwater To Marine Saline Gradient | MAGLTGLNYSSLDYVCRLYSVKDPVSLFEGIQVMEVAALACLNKRKP* |
| Ga0129336_100998382 | 3300010370 | Freshwater To Marine Saline Gradient | MAGLTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR* |
| Ga0129336_104927632 | 3300010370 | Freshwater To Marine Saline Gradient | MAGLTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNAKRK* |
| Ga0163212_11241841 | 3300013087 | Freshwater | MAGLTGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK* |
| Ga0163212_12585191 | 3300013087 | Freshwater | YPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK* |
| (restricted) Ga0172375_101613891 | 3300013137 | Freshwater | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNASRK* |
| Ga0177922_104274164 | 3300013372 | Freshwater | AGLTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNAKRK* |
| Ga0177922_110806392 | 3300013372 | Freshwater | LIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNSKRK* |
| Ga0181364_10182681 | 3300017701 | Freshwater Lake | TGFNYQSLEWLCKLYAVKDLVAMFEGVQLMEMAALSAMNSKNK |
| Ga0181422_10204602 | 3300017762 | Seawater | DYLCRLYEVKDPVALFEGVQVMELTALASLNKKDS |
| Ga0181425_10314831 | 3300017771 | Seawater | MGGVSGLNYSSLDYLCRLYEVKDPVALFEGVQVMELTALASLNKKDS |
| Ga0181357_11732461 | 3300017777 | Freshwater Lake | QSLEWLCKLYAVKDLVAMFEGLQLMEMAALSAIHSKNK |
| Ga0181423_13693792 | 3300017781 | Seawater | LDYLCRLYEVKDPVALFEGVQVMELTALASLNKKDS |
| Ga0181348_10275131 | 3300017784 | Freshwater Lake | ATGFNYQSLEWLCKLYAVKDLVAMFEGVQLMEMAALSAMNSKNK |
| Ga0181348_11761991 | 3300017784 | Freshwater Lake | QSLEWLCKLYAVKDLVAMFEGVQLMEMAALSAIHSKNK |
| Ga0181590_101891061 | 3300017967 | Salt Marsh | LTGLNYPSLEWLCKLYSVKDPVALFEGVQVMETTALSVLNAERK |
| Ga0180438_111953401 | 3300017971 | Hypersaline Lake Sediment | NYSSLDYVCKLYSVKDPVSLFEGIQVMEVAVLACLNKRKP |
| Ga0181591_110364062 | 3300018424 | Salt Marsh | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAAL |
| Ga0194111_100786722 | 3300020083 | Freshwater Lake | LTGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194111_104388121 | 3300020083 | Freshwater Lake | LPKLGMLCKLYAVADPVAMFEGVQVMELAALAVMNRKSK |
| Ga0194115_100425251 | 3300020183 | Freshwater Lake | GLTGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194115_100542812 | 3300020183 | Freshwater Lake | MAGLTGLNYPSLQWLCKLYAVKDPVAIFEGVQVMESTALAVLNNTRGR |
| Ga0194115_101908741 | 3300020183 | Freshwater Lake | MAGLTGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194118_104249711 | 3300020190 | Freshwater Lake | LQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194128_100579621 | 3300020197 | Freshwater Lake | TGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194120_102750681 | 3300020198 | Freshwater Lake | PSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0194116_103008152 | 3300020204 | Freshwater Lake | VGMNGATGLHYPSLEWLCKLYAVADPVAMFEGVQVMELAALAEMNRKSK |
| Ga0194119_100853422 | 3300020220 | Freshwater Lake | SMAGLTGMNYPSLQWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0211705_101463872 | 3300020395 | Marine | MSGLTGLNYSSLPYLCKLYEVKDERLLFEGIQIMEMAALSCLHKKK |
| Ga0211708_101130352 | 3300020436 | Marine | MSGMTGLNYSSLEYLCKLYEVKDPVVLFEGIQVMEMAALSCMNKKK |
| Ga0208050_10016702 | 3300020498 | Freshwater | LIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR |
| Ga0208050_10096951 | 3300020498 | Freshwater | LIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNSKRK |
| Ga0208360_10111722 | 3300020551 | Freshwater | EWLCKLYSVKDPVAIFEGVQVMEMAALAVLNSKRK |
| Ga0194130_100092738 | 3300021376 | Freshwater Lake | GMNGATGLHYPSLEWLCKLYAVADPVAMFEGVQVMELAALAVMNRKSK |
| Ga0194130_100667711 | 3300021376 | Freshwater Lake | GMNGATGLHYPSLEWLCKLYAVADPVAMFEGVQVMELAALAVVNRKSK |
| Ga0194117_100496501 | 3300021424 | Freshwater Lake | QWLCKLYAVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0222713_105051381 | 3300021962 | Estuarine Water | NYPSLEWLCKLYSVKDPVAMFEGVQVMEMAALAVLNASRK |
| Ga0222712_100213691 | 3300021963 | Estuarine Water | PSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR |
| Ga0222719_101080901 | 3300021964 | Estuarine Water | GLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Ga0224906_10320771 | 3300022074 | Seawater | YSSLDYLCRLYEVKDPVALFEGVQVMELTALASLNKKDS |
| Ga0181354_11369531 | 3300022190 | Freshwater Lake | SGATGFNYQSLEWLCKLYTVKDLVAMFEGVQLMEMAALSAMNSKNK |
| Ga0196905_10154151 | 3300022198 | Aqueous | GLNYPSLEWLCKLYSVKDPVAIFEGIQVMESAALAILNSKRAS |
| Ga0196905_10791432 | 3300022198 | Aqueous | EWLCKLYSVKDPVAIFEGVQVMEMAALSVLNAKSK |
| Ga0196901_12241521 | 3300022200 | Aqueous | LVGLNYQSLEWLCKLYAVGDPVALLEGIQVMEHAALAYFQETRK |
| Ga0255751_100547922 | 3300023116 | Salt Marsh | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNKKS |
| Ga0209336_100616791 | 3300025137 | Marine | LNYSSVEYLGRLYPAKDPVALFEGLQVMEIKALTCLNKKNS |
| Ga0208161_10629402 | 3300025646 | Aqueous | MAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Ga0208428_11077382 | 3300025653 | Aqueous | LTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNTKS |
| Ga0208795_10976661 | 3300025655 | Aqueous | LTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEGAALAILNSKRAS |
| Ga0208898_10300552 | 3300025671 | Aqueous | SMAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Ga0208162_10114472 | 3300025674 | Aqueous | MTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALACMNANRK |
| Ga0208162_10185412 | 3300025674 | Aqueous | MAGLTGLNYPSLEWLCKLYSVKDPVALFEGVQVMETTALSVLNAERK |
| Ga0208019_10230861 | 3300025687 | Aqueous | NYPSLEWLCKLYSVKDPVAIFEGVQVMEGAALAILNSKRAS |
| Ga0208785_10933361 | 3300025815 | Aqueous | TGMSGAVGLNYPSLEWLCKLYAVKDPVAIFEGVQIMELATLAIMNADRK |
| Ga0208645_11003122 | 3300025853 | Aqueous | GLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAALNTKS |
| Ga0209246_100062831 | 3300027785 | Freshwater Lake | AGMSGATGFNYQSLEWLCKLYAVKDLVAMFEGLQLMEMAALSAIHSKNK |
| Ga0209353_100209371 | 3300027798 | Freshwater Lake | ATGFNYQSLEWLCKLYTVKDLVAMFEGVQLMEMAALSAMNSKNK |
| Ga0209353_100309291 | 3300027798 | Freshwater Lake | EWLCKLYAVKDLVAMFEGVQLMEIAALSAMNSKNK |
| Ga0209353_101952682 | 3300027798 | Freshwater Lake | ATGFNYQSLEWLCKLYAVKDLVAMFEGVQLMEIAALSAMNSKNK |
| Ga0209536_1019571422 | 3300027917 | Marine Sediment | YPSLEWLCKLYSVKDPVAIFEGVQVMELAALAVLNANRK |
| (restricted) Ga0233417_102009731 | 3300028043 | Sediment | YPSLEWLCKLYTVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0119944_10014081 | 3300029930 | Aquatic | SMAGLTGLNYPSLEWLCKLYSVKDPVAMFEGVQVMEMAALAVLNASRK |
| Ga0119944_10014721 | 3300029930 | Aquatic | EWLCKLYSVKDPVAVFEGVQVMEMAALAVLNNNRGR |
| Ga0119944_10023874 | 3300029930 | Aquatic | SMAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0119944_10399161 | 3300029930 | Aquatic | EWLCKLYSVKDPVAVFEGVQVMEMAALAVLNASRK |
| Ga0119945_10021343 | 3300029933 | Aquatic | MAGLTGLNYPSLEWLCKLYSVKDPVAVFEGVQVMEMAALAVLNNNRGR |
| Ga0119945_10024621 | 3300029933 | Aquatic | GLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNASRK |
| Ga0307380_107635291 | 3300031539 | Soil | PSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Ga0307379_102170111 | 3300031565 | Soil | TSMAGLTGLNYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKSK |
| Ga0315330_101192571 | 3300032047 | Seawater | SSLEYLCKLYEVKDPVVLFEGIQVMEMTALSCMNKKK |
| Ga0315330_102155813 | 3300032047 | Seawater | MSGLTGLNYSSLPYLCKLYEVKDERLLFEGIQIMEMSALSCLHKKK |
| Ga0334978_0402024_3_119 | 3300033979 | Freshwater | PSLEWLCKLYSVKDPVAVFEGVQVMEMAALSVLNASRK |
| Ga0334982_0031956_2876_2983 | 3300033981 | Freshwater | LEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR |
| Ga0335066_0041324_2983_3114 | 3300034112 | Freshwater | LTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNAKR |
| Ga0335053_0320289_12_155 | 3300034118 | Freshwater | MAGLTGLIYPSLEWLCKLYSVKDPVAIFEGVQVMEMAALAVLNSKRK |
| Ga0348337_180963_1_132 | 3300034418 | Aqueous | LTGLNYPSLEWLCKLYSVKDPVAIFEGIQVMESTVLVILNKKS |
| ⦗Top⦘ |