Metagenome Family F086830

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F086830
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	40 residues
Representative Sequence	TMTILSKYIDNLTLNVESEKLKTLMRELYVEALNTERTE
Number of Associated Samples	88
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	3.64 %
% of genes near scaffold ends (potentially truncated)	91.82 %
% of genes from short scaffolds (< 2000 bps)	87.27 %
Associated GOLD sequencing projects	83
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.909 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.818 % of family members)
Environment Ontology (ENVO)	Unclassified (60.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (64.545 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF13476	AAA_23	67.27
PF13640	2OG-FeII_Oxy_3	10.91
PF01327	Pep_deformylase	6.36
PF02463	SMC_N	1.82
PF13555	AAA_29	1.82
PF01555	N6_N4_Mtase	0.91
PF00149	Metallophos	0.91
PF04851	ResIII	0.91
PF02945	Endonuclease_7	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0242	Peptide deformylase	Translation, ribosomal structure and biogenesis [J]	6.36
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.91
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.91
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
All Organisms	root	All Organisms	49.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
Viruses	superkingdom	All Organisms → Viruses	40.91 %
cellular organisms	root	All Organisms → cellular organisms	8.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.36 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	1.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.64 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	1.82 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Rickettsiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales	1.82 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.82 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	21.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	5.45 %
unclassified Rickettsiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales	1.82 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.82 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	4.55 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.82 %
Candidatus Endolissoclinum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum	1.82 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
unclassified Candidatus Endolissoclinum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum	1.82 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.82 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
unclassified Myoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae	0.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.91 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.64 %
Candidatus Endolissoclinum sp. TMED37	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	1.82 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.82 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1.82 %
Pelagibacter phage HTVC008M	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M	0.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035265000\|ErSWdraf_F5BXKTZ02F3ZI2	Not Available	502	Open in IMG/M
3300001838\|RCM33_1000549	All Organisms → Viruses → Predicted Viral	2697	Open in IMG/M
3300001843\|RCM34_1007752	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	1092	Open in IMG/M
3300002835\|B570J40625_100198337	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	2181	Open in IMG/M
3300002835\|B570J40625_100571419	All Organisms → Viruses → Predicted Viral	1042	Open in IMG/M
3300005581\|Ga0049081_10041804	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1740	Open in IMG/M
3300005582\|Ga0049080_10002473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	6362	Open in IMG/M
3300005582\|Ga0049080_10216445	Not Available	630	Open in IMG/M
3300005662\|Ga0078894_11148539	Not Available	660	Open in IMG/M
3300006802\|Ga0070749_10561304	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	618	Open in IMG/M
3300006875\|Ga0075473_10436476	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	529	Open in IMG/M
3300007540\|Ga0099847_1243193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	518	Open in IMG/M
3300007974\|Ga0105747_1274428	Not Available	567	Open in IMG/M
3300007992\|Ga0105748_10564152	Not Available	501	Open in IMG/M
3300008110\|Ga0114343_1094572	All Organisms → Viruses → Predicted Viral	1046	Open in IMG/M
3300008117\|Ga0114351_1449659	Not Available	521	Open in IMG/M
3300008120\|Ga0114355_1036949	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2765	Open in IMG/M
3300008259\|Ga0114841_1076993	All Organisms → Viruses → Predicted Viral	1524	Open in IMG/M
3300008267\|Ga0114364_1038504	All Organisms → Viruses → Predicted Viral	1805	Open in IMG/M
3300008448\|Ga0114876_1020898	All Organisms → Viruses → Predicted Viral	3402	Open in IMG/M
3300008448\|Ga0114876_1157870	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	818	Open in IMG/M
3300009068\|Ga0114973_10150642	All Organisms → Viruses → Predicted Viral	1293	Open in IMG/M
3300009154\|Ga0114963_10226932	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1069	Open in IMG/M
3300009155\|Ga0114968_10051000	All Organisms → Viruses → Predicted Viral	2666	Open in IMG/M
3300009164\|Ga0114975_10277940	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	931	Open in IMG/M
3300009164\|Ga0114975_10431296	Not Available	716	Open in IMG/M
3300009169\|Ga0105097_10441858	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	725	Open in IMG/M
3300009181\|Ga0114969_10707277	Not Available	542	Open in IMG/M
3300009184\|Ga0114976_10133953	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1397	Open in IMG/M
3300009187\|Ga0114972_10466769	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	719	Open in IMG/M
3300009507\|Ga0115572_10611279	Not Available	600	Open in IMG/M
3300009785\|Ga0115001_10016023	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M	5053	Open in IMG/M
3300010157\|Ga0114964_10313066	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	744	Open in IMG/M
3300010160\|Ga0114967_10650796	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	503	Open in IMG/M
3300010885\|Ga0133913_11115564	All Organisms → Viruses → Predicted Viral	2030	Open in IMG/M
3300010885\|Ga0133913_11406376	Not Available	1774	Open in IMG/M
3300010885\|Ga0133913_13178471	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1087	Open in IMG/M
3300011010\|Ga0139557_1002474	All Organisms → Viruses → Predicted Viral	4112	Open in IMG/M
3300012013\|Ga0153805_1072422	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	584	Open in IMG/M
3300012920\|Ga0160423_10347793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1017	Open in IMG/M
3300013372\|Ga0177922_10298575	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	577	Open in IMG/M
3300013372\|Ga0177922_10584650	Not Available	612	Open in IMG/M
3300017744\|Ga0181397_1151015	Not Available	594	Open in IMG/M
3300017756\|Ga0181382_1103129	Not Available	771	Open in IMG/M
3300017761\|Ga0181356_1076251	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1118	Open in IMG/M
3300017766\|Ga0181343_1084957	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300017766\|Ga0181343_1084958	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300017766\|Ga0181343_1161386	Not Available	622	Open in IMG/M
3300017766\|Ga0181343_1194330	Not Available	557	Open in IMG/M
3300017784\|Ga0181348_1295596	Not Available	544	Open in IMG/M
3300017785\|Ga0181355_1147705	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	950	Open in IMG/M
3300017785\|Ga0181355_1173707	Not Available	859	Open in IMG/M
3300018416\|Ga0181553_10613726	Not Available	574	Open in IMG/M
3300020048\|Ga0207193_1543763	Not Available	771	Open in IMG/M
3300020161\|Ga0211726_10132349	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1199	Open in IMG/M
3300020161\|Ga0211726_10770906	Not Available	1088	Open in IMG/M
3300020172\|Ga0211729_10309378	Not Available	564	Open in IMG/M
3300020172\|Ga0211729_10519705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	809	Open in IMG/M
3300020172\|Ga0211729_11062812	All Organisms → Viruses → Predicted Viral	1635	Open in IMG/M
3300020183\|Ga0194115_10001303	Not Available	32070	Open in IMG/M
3300020204\|Ga0194116_10334293	Not Available	780	Open in IMG/M
3300020221\|Ga0194127_10716233	Not Available	625	Open in IMG/M
3300020527\|Ga0208232_1014865	Not Available	1162	Open in IMG/M
3300021093\|Ga0194123_10140857	Not Available	1316	Open in IMG/M
3300021959\|Ga0222716_10316527	Not Available	936	Open in IMG/M
3300021961\|Ga0222714_10331608	Not Available	824	Open in IMG/M
3300023179\|Ga0214923_10060389	Not Available	2803	Open in IMG/M
3300024289\|Ga0255147_1095595	Not Available	548	Open in IMG/M
3300024515\|Ga0255183_1106096	Not Available	547	Open in IMG/M
3300025436\|Ga0208103_1047381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	594	Open in IMG/M
3300025889\|Ga0208644_1401555	Not Available	504	Open in IMG/M
3300027586\|Ga0208966_1007483	All Organisms → Viruses → Predicted Viral	3271	Open in IMG/M
3300027608\|Ga0208974_1130619	Not Available	650	Open in IMG/M
3300027621\|Ga0208951_1178714	Not Available	539	Open in IMG/M
3300027736\|Ga0209190_1324504	Not Available	579	Open in IMG/M
3300027747\|Ga0209189_1384570	Not Available	525	Open in IMG/M
3300027749\|Ga0209084_1218521	Not Available	757	Open in IMG/M
3300027749\|Ga0209084_1289965	Not Available	621	Open in IMG/M
3300027759\|Ga0209296_1002187	Not Available	14274	Open in IMG/M
3300027759\|Ga0209296_1161733	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	995	Open in IMG/M
3300027760\|Ga0209598_10315112	Not Available	607	Open in IMG/M
3300027772\|Ga0209768_10340257	Not Available	617	Open in IMG/M
3300027782\|Ga0209500_10280483	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	714	Open in IMG/M
3300027963\|Ga0209400_1332036	Not Available	570	Open in IMG/M
3300028275\|Ga0255174_1048213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731	Open in IMG/M
3300028394\|Ga0304730_1146123	Not Available	956	Open in IMG/M
3300028394\|Ga0304730_1238090	Not Available	663	Open in IMG/M
3300031758\|Ga0315907_10319503	All Organisms → Viruses → Predicted Viral	1271	Open in IMG/M
3300031758\|Ga0315907_11004405	Not Available	602	Open in IMG/M
3300031784\|Ga0315899_10265737	Not Available	1707	Open in IMG/M
3300031787\|Ga0315900_10363319	All Organisms → Viruses → Predicted Viral	1161	Open in IMG/M
3300031787\|Ga0315900_10929625	Not Available	581	Open in IMG/M
3300031857\|Ga0315909_10577927	Not Available	756	Open in IMG/M
3300031857\|Ga0315909_10992530	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300032092\|Ga0315905_10310978	Not Available	1509	Open in IMG/M
3300033233\|Ga0334722_10683764	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	730	Open in IMG/M
3300033979\|Ga0334978_0606142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	504	Open in IMG/M
3300033992\|Ga0334992_0359940	Not Available	664	Open in IMG/M
3300033994\|Ga0334996_0020902	All Organisms → Viruses → Predicted Viral	4255	Open in IMG/M
3300033994\|Ga0334996_0294674	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	810	Open in IMG/M
3300034061\|Ga0334987_0421649	Not Available	838	Open in IMG/M
3300034072\|Ga0310127_263719	Not Available	605	Open in IMG/M
3300034072\|Ga0310127_282625	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300034082\|Ga0335020_0243735	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	891	Open in IMG/M
3300034102\|Ga0335029_0212776	Not Available	1275	Open in IMG/M
3300034103\|Ga0335030_0497778	Not Available	769	Open in IMG/M
3300034107\|Ga0335037_0626875	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	566	Open in IMG/M
3300034109\|Ga0335051_0511708	Not Available	557	Open in IMG/M
3300034112\|Ga0335066_0685257	Not Available	519	Open in IMG/M
3300034283\|Ga0335007_0326054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	994	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.18%
Terrestrial	Environmental → Terrestrial	1.82%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	85.45%
Marine	Environmental → Aquatic → Marine	12.73%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.82%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	51.82%
Lentic	Environmental → Aquatic → Freshwater → Lentic	19.09%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	7.27%
Coastal	Environmental → Aquatic → Marine → Coastal	5.45%
River	Environmental → Aquatic → Freshwater → River	2.73%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.82%
Ice	Environmental → Aquatic → Freshwater → Ice	1.82%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.82%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.82%
Strait	Environmental → Aquatic → Marine → Strait	1.82%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.91%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.91%
Pelagic	Environmental → Aquatic → Marine → Pelagic	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	50.00%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	16.36%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	7.27%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	5.45%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.73%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.73%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	1.82%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.91%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.91%
Photic Zone	Environmental → Aquatic → Marine → Oceanic → Photic Zone	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.91%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	21.82%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	9.09%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	7.27%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.36%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.45%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.45%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.55%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.64%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.73%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.73%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.82%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	1.82%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.82%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.82%
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	1.82%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	1.82%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.91%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.91%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.91%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.91%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.91%
Surface Seawater	Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.91%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035265000	Freshwater microbial communities from Swedish Lakes - surface of Lake Erken	Environmental	Open in IMG/M
3300001838	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a	Environmental	Open in IMG/M
3300001843	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007540	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300009507	Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607	Environmental	Open in IMG/M
3300009785	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300012920	Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017744	Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23	Environmental	Open in IMG/M
3300017756	Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021093	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface	Environmental	Open in IMG/M
3300021959	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024515	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d	Environmental	Open in IMG/M
3300025436	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes)	Environmental	Open in IMG/M
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027760	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028275	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034072	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034107	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ErSWdraft_5494000	2035265000	Freshwater	MTILSKYIDGLTLDVDSVKLKNLMRELYIESLNVEVTE
RCM33_10005491	3300001838	Marine Plankton	EDTMSILSNYIDGATLDVNNEKLKTIMRELYVEAVNAERSE*
RCM34_10077521	3300001843	Marine Plankton	DTMTILSKYIDNLTLNVDNVKLKNLMKELYVEALTTETE*
B570J40625_1001983371	3300002835	Freshwater	EDTITILSKYIDNLTLDVEPEKLKTLMRELYVEALNTEVAE*
B570J40625_1005714192	3300002835	Freshwater	QEIIDQAEDTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE*
Ga0049081_100418041	3300005581	Freshwater Lentic	TMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE*
Ga0049080_100024731	3300005582	Freshwater Lentic	AEDTMTILSKYIDNLTLNVERDKLKNLMKELYVEALNTETTE*
Ga0049080_102164452	3300005582	Freshwater Lentic	AEDTMTILSKYIDNLTLNVERDKLKNLMKELYVEALNTETSE*
Ga0078894_111485391	3300005662	Freshwater Lake	ILSKYIDNLTLNVDNDKLKTLMKELYVEALTTETE*
Ga0070749_105613042	3300006802	Aqueous	FSILSKYIDNLTLDVDPKQLKVIMKEIYVEALSTEKAE*
Ga0075473_104364761	3300006875	Aqueous	QAEDTMTILGKYIDNLTLNVDNDKLKALMREIYIEALTTETE*
Ga0099847_12431931	3300007540	Aqueous	EDTMTILSKYIDGLTLNVEPDKLKKIMRELYVESLTTEIIE*
Ga0105747_12744281	3300007974	Estuary Water	QAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEIAE*
Ga0105748_105641522	3300007992	Estuary Water	DADDDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEVSE*
Ga0114343_10945722	3300008110	Freshwater, Plankton	ITILSKYIDNLTLDVEPEKLKTLMRELYVEALNTEVAE*
Ga0114351_14496592	3300008117	Freshwater, Plankton	IDQAEDTMTILSKYIDNLSLDVEPEKLKILMRELYVEALNTEVAE*
Ga0114355_10369494	3300008120	Freshwater, Plankton	MTILSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE*
Ga0114841_10769931	3300008259	Freshwater, Plankton	VDQAEDTMTILSKYIDNLTINVEPVKLKSIMQELYVEALSTTTE*
Ga0114364_10385041	3300008267	Freshwater, Plankton	DQAEDTMTILGKYIDNLTLNVESDKLKTLMRELYIEALNTETTE*
Ga0114876_10208985	3300008448	Freshwater Lake	ILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE*
Ga0114876_11578701	3300008448	Freshwater Lake	SKYIDNLTLDVQPEKLKTLMRELYVEALNTEVAE*
Ga0114973_101506421	3300009068	Freshwater Lake	TMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE*
Ga0114963_102269321	3300009154	Freshwater Lake	IDQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE*
Ga0114968_100510001	3300009155	Freshwater Lake	QAEDTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALSSDTE*
Ga0114975_102779403	3300009164	Freshwater Lake	DQAEDTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE*
Ga0114975_104312963	3300009164	Freshwater Lake	DTMTILSKYIDGLSLNVESEKLKTLMRELYVEALNLEKIE*
Ga0105097_104418582	3300009169	Freshwater Sediment	EDQDLVDQAEDTMTILSKFIDNMTLDIETTKLKTIIREVYIEALNTEKTE*
Ga0114969_107072771	3300009181	Freshwater Lake	DTMTILGKYIDNLTLNVESDKLKSLMRELYIEALNTETTE*
Ga0114976_101339532	3300009184	Freshwater Lake	MTILSKYIDGLTLNVESEKLKTLMRELYVEALNLEKIE*
Ga0114972_104667692	3300009187	Freshwater Lake	EIVDQAEDTMTILSKYIDNLTLNVENEKLKILMRELYVEALNTERTE*
Ga0115572_106112792	3300009507	Pelagic Marine	TILSNYIDQQGVDVDSNKLKNLMRELYVEALAQETI*
Ga0115001_100160235	3300009785	Marine	NQAEDTMTILSKYIDGLSLNVESEKLKTLMRELYVEALHTEETD*
Ga0114964_103130662	3300010157	Freshwater Lake	EDTMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE*
Ga0114967_106507962	3300010160	Freshwater Lake	SKYIDGLTLDVDSDKLKNLMRELYVESLNVEVTE*
Ga0133913_111155644	3300010885	Freshwater Lake	LSHFIDNSQLNVETDKLKSLMRELYVEALNTEKAE*
Ga0133913_114063761	3300010885	Freshwater Lake	QDIVDQAEDTMTILSKYIDGLELNVESNKLKSIMKEVYIEALNTETTE*
Ga0133913_131784711	3300010885	Freshwater Lake	TMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE*
Ga0139557_10024742	3300011010	Freshwater	MTILSKYIDNLELNVDNEKLKTFMRELYVEALNTENIE*
Ga0153805_10724222	3300012013	Surface Ice	DTMTILSKYIDNLELNVDNEKLKTFMRELYVEALNTENIE*
Ga0160423_103477931	3300012920	Surface Seawater	MTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERV*
Ga0177922_102985752	3300013372	Freshwater	DTMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE*
Ga0177922_105846501	3300013372	Freshwater	LSKYIDNLTINVERDKLKNLMKELYVEALNTETSE*
Ga0181397_11510151	3300017744	Seawater	DTMTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERT
Ga0181382_11031291	3300017756	Seawater	NQAEDTMTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERT
Ga0181356_10762513	3300017761	Freshwater Lake	DQAEDTMTILSKHIDNLTLNVNNEKLKTLMRELYVEALNTEVSE
Ga0181343_10849573	3300017766	Freshwater Lake	DDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEIAE
Ga0181343_10849583	3300017766	Freshwater Lake	DDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEVSE
Ga0181343_11613861	3300017766	Freshwater Lake	DTMTILSKYIDNLTLNVESDKLKGLMRELYVEALNTETE
Ga0181343_11943301	3300017766	Freshwater Lake	MTILSKYIDNLTLNVNSDKLKTLMRELYVEALNTETTE
Ga0181348_12955961	3300017784	Freshwater Lake	ILSKYIDNLTLNVECEKLKTLMRELYIEALNTETTE
Ga0181355_11477053	3300017785	Freshwater Lake	TILSKHIDNLTLNVNNEKLKTLMRELYVEALNTEVSE
Ga0181355_11737071	3300017785	Freshwater Lake	DTMTILGKYIDNLTLNVESDKLKTLMRELYIEALNTETTE
Ga0181553_106137262	3300018416	Salt Marsh	LSKYIDALELDVENDKLKKIMRELYVEALTTEVTD
Ga0207193_15437631	3300020048	Freshwater Lake Sediment	DLVDQAEDTMTILSKFIDGLATNVDSTKLKGLMRELYVESLNVEIIE
Ga0211726_101323491	3300020161	Freshwater	ILSKYIDNLPLDVEPEKLKAIMRELYIEAINTEVAE
Ga0211726_107709061	3300020161	Freshwater	TILSKYIDNLTLTVDNDKLKTLMKELYVEALTTETE
Ga0211729_103093781	3300020172	Freshwater	AEDTVTILSKYIDNLTLNVDNDKLKGLMRELYVEALNTEIE
Ga0211729_105197051	3300020172	Freshwater	MTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE
Ga0211729_110628122	3300020172	Freshwater	ILSKYIDNLTLNVESDKLKGLMRELYVEALNTETE
Ga0194115_1000130335	3300020183	Freshwater Lake	MTILNRYIDNLALNVNGDKLKTLMRELYVEALNTETTE
Ga0194116_103342931	3300020204	Freshwater Lake	QAEDTVTILSKYIDNLTLNVENDKLKGLMRELYVEALNIQIE
Ga0194127_107162332	3300020221	Freshwater Lake	SLSKYIDNLELEVEPDKLKTLMRELYVEALNTEVAE
Ga0208232_10148652	3300020527	Freshwater	ILSKYIDNLTLNVNSDKLKTLMRELYVEAINTETTE
Ga0194123_101408571	3300021093	Freshwater Lake	IIDQAEDTMTILSKYIDALELDIENDQLKKLMRELYVEALNTEVTD
Ga0222716_103165272	3300021959	Estuarine Water	LSKYIDGLKLEVNNEKLKDIMRELYTEALHTEETD
Ga0222714_103316081	3300021961	Estuarine Water	DTMTILSKYIDNLTLNVEAEKLKTLMRELYVEAINTETTE
Ga0214923_100603895	3300023179	Freshwater	LSKHIDNLTLNVNNEKLKTLMRELYVEALNTETTE
Ga0255147_10955952	3300024289	Freshwater	MTILSKYIDNLTLNVESDKLKQVMQELYVEALSTETE
Ga0255183_11060961	3300024515	Freshwater	VTILSKYIDNLTLNVDNDKLKVLMRELYVEALNTNIE
Ga0208103_10473813	3300025436	Freshwater	DTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALNTETE
Ga0208644_14015552	3300025889	Aqueous	QAEDTMTILSKYIDNLELDVESEKLKKLMRELYVEALNTEIAE
Ga0208966_10074836	3300027586	Freshwater Lentic	QAEDTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE
Ga0208974_11306192	3300027608	Freshwater Lentic	ILSKYIDNLTLNVESDKLKTLMRELYIEALNTETTE
Ga0208951_11787142	3300027621	Freshwater Lentic	EDTMTILSRYIDNLTLNVESDKLKSLMRELYIEALNTETTE
Ga0209190_13245041	3300027736	Freshwater Lake	IDQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE
Ga0209189_13845702	3300027747	Freshwater Lake	DTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE
Ga0209084_12185212	3300027749	Freshwater Lake	MTILSKYIDNLTLTVDNDKLKTLMKELYVEALNTETE
Ga0209084_12899651	3300027749	Freshwater Lake	TMTILSKYIDNLTLTVENDKLKILMRELYVEALTTETE
Ga0209296_100218719	3300027759	Freshwater Lake	EDTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALSSDTE
Ga0209296_11617331	3300027759	Freshwater Lake	AEDTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE
Ga0209598_103151121	3300027760	Freshwater Lake	DQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE
Ga0209768_103402571	3300027772	Freshwater Lake	MTILSRYIDNLTLNVESEKLKTLMRELYIEALNTETTE
Ga0209500_102804832	3300027782	Freshwater Lake	ILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE
Ga0209400_13320361	3300027963	Freshwater Lake	DEDTMTILGKYIDNLTLNVESDKLKSLMRELYIEALNTETTE
Ga0255174_10482132	3300028275	Freshwater	TMTILSKYIDGLQLNVEPDKLKTVMRELYVEALNVEKTE
Ga0304730_11461232	3300028394	Freshwater Lake	ILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE
Ga0304730_12380902	3300028394	Freshwater Lake	EDTMTILSKYIDNLTLNVESDKLKSLMRELYIEALNTETTE
Ga0315907_103195032	3300031758	Freshwater	LSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE
Ga0315907_110044052	3300031758	Freshwater	QELIDQAEDTMTILSKYIDNLTINVESDKLKKIMQELYVEALSTTTE
Ga0315899_102657372	3300031784	Freshwater	ILSKYIDGLTLDVDSDKLKNLMRELYVESLNVEVTE
Ga0315900_103633192	3300031787	Freshwater	EDTMTILSKYIDNLSLDVEPEKLKILMRELYVEALNTEVAE
Ga0315900_109296251	3300031787	Freshwater	TMTILSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE
Ga0315909_105779272	3300031857	Freshwater	QELVDQAEDTMTILSKYIDNLTINVEPVKLKSIMQELYVEALSTTTE
Ga0315909_109925302	3300031857	Freshwater	DTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE
Ga0315905_103109782	3300032092	Freshwater	SAIDDQEIIDQAEDTMTILSKYIDNLTLDVEPDKLKNLMKEVYIEALNTETTE
Ga0334722_106837641	3300033233	Sediment	DQAEDTMTILGKYIDNLTLSVESDKLKTLMRELYIEALNTETTEC
Ga0334978_0606142_373_489	3300033979	Freshwater	MTILSKYIDNLPLDVEPEKLKSIMRELYIEAINTEVAE
Ga0334992_0359940_556_663	3300033992	Freshwater	LSKYIDNLTLNVNSDKLKTLMRELYVEAINTETTE
Ga0334996_0020902_31_147	3300033994	Freshwater	MTILSKYIDGLATNVDSTKLKGLMRELYVESLNVEIIE
Ga0334996_0294674_13_129	3300033994	Freshwater	MTILSKYIDNLTLNVEAEKLKTLMRELYVEALNTEKAE
Ga0334987_0421649_1_150	3300034061	Freshwater	VDQELIDQAEDTMTILSKYIDNLTINVEPDRLKKIMQELYVEALSTTTE
Ga0310127_263719_480_602	3300034072	Fracking Water	MTILSKYIDGQELNVAPNRLKNLMQELYVEALSLETESNA
Ga0310127_282625_10_126	3300034072	Fracking Water	MTILSKHIDNLTLDVEAEKLKTLMRELYIEALNTEIAE
Ga0335020_0243735_770_889	3300034082	Freshwater	TMTILSKYIDNLTLNVESEKLKTLMRELYVEALNTERTE
Ga0335029_0212776_1152_1274	3300034102	Freshwater	EDTVTILSKYIDNLTLNVENDKLKNLMRELYVEALNTELE
Ga0335030_0497778_661_768	3300034103	Freshwater	LSKYIDNLTLDVEPEKLKTLVRELYVEALNTEVAE
Ga0335037_0626875_13_129	3300034107	Freshwater	MTILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE
Ga0335051_0511708_447_557	3300034109	Freshwater	ILSKYIDNLTLDVEPEKLKTLVRELYVEALNTEVAE
Ga0335066_0685257_2_145	3300034112	Freshwater	EVIDQAEDTITILNKYIDGLTTNIESDKLKKIMRELYVEAINMESIE
Ga0335007_0326054_881_994	3300034283	Freshwater	TILSKYIDNLTLDVESDKLKNIMRELYVEALNTEVAE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F086830

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences