Basic Information | |
---|---|
Family ID | F086718 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 45 residues |
Representative Sequence | TALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.82 % |
% of genes near scaffold ends (potentially truncated) | 98.18 % |
% of genes from short scaffolds (< 2000 bps) | 97.27 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.273 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.636 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 14.71% Coil/Unstructured: 61.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00196 | GerE | 12.73 |
PF00571 | CBS | 2.73 |
PF00378 | ECH_1 | 2.73 |
PF13692 | Glyco_trans_1_4 | 1.82 |
PF01266 | DAO | 1.82 |
PF13858 | DUF4199 | 1.82 |
PF00293 | NUDIX | 0.91 |
PF05016 | ParE_toxin | 0.91 |
PF13474 | SnoaL_3 | 0.91 |
PF01223 | Endonuclease_NS | 0.91 |
PF13189 | Cytidylate_kin2 | 0.91 |
PF00348 | polyprenyl_synt | 0.91 |
PF00999 | Na_H_Exchanger | 0.91 |
PF01872 | RibD_C | 0.91 |
PF00881 | Nitroreductase | 0.91 |
PF08447 | PAS_3 | 0.91 |
PF13946 | DUF4214 | 0.91 |
PF00326 | Peptidase_S9 | 0.91 |
PF09285 | Elong-fact-P_C | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.91 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.91 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.91 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.91 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.91 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.91 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.91 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.91 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.27 % |
Unclassified | root | N/A | 2.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17429696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104649426 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300000789|JGI1027J11758_12211335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300002407|C687J29651_10138193 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300004782|Ga0062382_10505960 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005166|Ga0066674_10082689 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300005171|Ga0066677_10552135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300005187|Ga0066675_11421763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 508 | Open in IMG/M |
3300005340|Ga0070689_100335074 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300005343|Ga0070687_100896251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300005355|Ga0070671_101535479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300005436|Ga0070713_101482204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300005439|Ga0070711_100922679 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300005440|Ga0070705_100699089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300005441|Ga0070700_100182677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1461 | Open in IMG/M |
3300005441|Ga0070700_100326745 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300005444|Ga0070694_101480889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300005451|Ga0066681_10660606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300005466|Ga0070685_10845364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300005518|Ga0070699_101316905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300005543|Ga0070672_101135615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 695 | Open in IMG/M |
3300005546|Ga0070696_101639146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300005556|Ga0066707_10347029 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300005563|Ga0068855_102054270 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005568|Ga0066703_10877249 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005598|Ga0066706_10337591 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300005617|Ga0068859_100543267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
3300005719|Ga0068861_101781296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300005842|Ga0068858_102033287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 568 | Open in IMG/M |
3300005844|Ga0068862_100510829 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300006046|Ga0066652_100534480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300006046|Ga0066652_100908917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 839 | Open in IMG/M |
3300006046|Ga0066652_101519555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300006871|Ga0075434_100579874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300006871|Ga0075434_101093830 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300006876|Ga0079217_11723508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300007258|Ga0099793_10447144 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300009089|Ga0099828_11054930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300009098|Ga0105245_11699316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 683 | Open in IMG/M |
3300009137|Ga0066709_102517444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300009147|Ga0114129_10408772 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300009147|Ga0114129_12569555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300009147|Ga0114129_12865457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 571 | Open in IMG/M |
3300009148|Ga0105243_11077627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 810 | Open in IMG/M |
3300009176|Ga0105242_11563871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 692 | Open in IMG/M |
3300009177|Ga0105248_12778819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300009553|Ga0105249_10066014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3330 | Open in IMG/M |
3300010159|Ga0099796_10296267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 684 | Open in IMG/M |
3300010301|Ga0134070_10192329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 746 | Open in IMG/M |
3300010304|Ga0134088_10510747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300010371|Ga0134125_11398489 | Not Available | 763 | Open in IMG/M |
3300010371|Ga0134125_13048214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 508 | Open in IMG/M |
3300010397|Ga0134124_11029420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300010399|Ga0134127_13176915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300010399|Ga0134127_13454950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300011119|Ga0105246_11039972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300012021|Ga0120192_10069435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 664 | Open in IMG/M |
3300012198|Ga0137364_11360446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 527 | Open in IMG/M |
3300012202|Ga0137363_11124884 | Not Available | 668 | Open in IMG/M |
3300012351|Ga0137386_10475877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
3300012354|Ga0137366_11109371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group → Ammoniphilus → Ammoniphilus resinae | 544 | Open in IMG/M |
3300012530|Ga0136635_10217966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300012532|Ga0137373_10558728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6 | 867 | Open in IMG/M |
3300012582|Ga0137358_10986465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 546 | Open in IMG/M |
3300012681|Ga0136613_10306654 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300012683|Ga0137398_10578930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 775 | Open in IMG/M |
3300012896|Ga0157303_10286876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 519 | Open in IMG/M |
3300012937|Ga0162653_100058518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300012944|Ga0137410_11491307 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300012948|Ga0126375_10269122 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300012948|Ga0126375_11149247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 643 | Open in IMG/M |
3300012987|Ga0164307_11912033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300013297|Ga0157378_11477764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 724 | Open in IMG/M |
3300013306|Ga0163162_11246279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300013308|Ga0157375_11200939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300014157|Ga0134078_10032317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
3300014157|Ga0134078_10672512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 504 | Open in IMG/M |
3300014326|Ga0157380_12529952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300015245|Ga0137409_10716255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 835 | Open in IMG/M |
3300015253|Ga0180081_1087597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300015371|Ga0132258_10517634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2986 | Open in IMG/M |
3300018028|Ga0184608_10382165 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300018071|Ga0184618_10505281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300018084|Ga0184629_10122958 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300018429|Ga0190272_10601714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
3300018466|Ga0190268_11209631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 627 | Open in IMG/M |
3300018469|Ga0190270_11966154 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300018920|Ga0190273_10031520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2505 | Open in IMG/M |
3300018920|Ga0190273_10408916 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300019487|Ga0187893_10265006 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300019767|Ga0190267_10966806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300025936|Ga0207670_10638144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300025941|Ga0207711_11670881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300025941|Ga0207711_12111229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 506 | Open in IMG/M |
3300025949|Ga0207667_11579830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 625 | Open in IMG/M |
3300026023|Ga0207677_11090926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300026089|Ga0207648_10565185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
3300026142|Ga0207698_11842249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300026142|Ga0207698_12669605 | Not Available | 508 | Open in IMG/M |
3300026296|Ga0209235_1060510 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300026318|Ga0209471_1086338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1377 | Open in IMG/M |
3300026318|Ga0209471_1123005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
3300026332|Ga0209803_1159973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300027681|Ga0208991_1227013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300027691|Ga0209485_1019836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
3300027876|Ga0209974_10335241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300028047|Ga0209526_10136107 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300032179|Ga0310889_10653125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 546 | Open in IMG/M |
3300033004|Ga0335084_11270045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 734 | Open in IMG/M |
3300034172|Ga0334913_066619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.91% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.91% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.91% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03862120 | 2088090014 | Soil | VIPSRRRSIQXLRESDSIAAALNSMSIGRYRHIPVQKSDGSYYVTSIKHVLKYLARSEW |
INPhiseqgaiiFebDRAFT_1046494262 | 3300000364 | Soil | NKMSLGRYRRIPYQKSDGSFSVATIRSVLKYIAQEDW* |
JGI1027J11758_122113351 | 3300000789 | Soil | TAVXDLMTSXPEXLHEXDSVAAALNXMSMGRYRHIPVKXHDGSYIVTSIKSVLIYIAKEDW* |
C687J29651_101381931 | 3300002407 | Soil | DSVATALNKMYLGRYRHIPVLKGDGSYRVTSIKSVLKYIAGEDW* |
Ga0062382_105059601 | 3300004782 | Wetland Sediment | EKDSVATAVNKMSMGRYRHIPVRKTDGSYSVISIKHVLKYIAKAKW* |
Ga0066674_100826893 | 3300005166 | Soil | GKDARPDHTTVKELMSPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSFTSIKHVLKYIAKANW* |
Ga0066677_105521351 | 3300005171 | Soil | FLRETDSVATAVNKMSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKAEW* |
Ga0066675_114217632 | 3300005187 | Soil | SVATALNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW* |
Ga0070689_1003350742 | 3300005340 | Switchgrass Rhizosphere | SADPGTLDESNSVAEALNKMSLGRYRHLPYRKADGSYAVASIQSVLKYIAQEDW* |
Ga0070687_1008962512 | 3300005343 | Switchgrass Rhizosphere | SANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW* |
Ga0070671_1015354792 | 3300005355 | Switchgrass Rhizosphere | ANPEILRDTDSVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW* |
Ga0070713_1014822042 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW* |
Ga0070711_1009226791 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LNETDSVATAVNKMSMGRYRHIPIRKADGSYSVISIKHVLKYIAKAEW* |
Ga0070705_1006990891 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LNETDSVAAALNKMSLGRYRHIPVARNDGSYAVISIKNVLKYIAQENW* |
Ga0070700_1001826771 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TALSKMSLGRYRHIPVVKADGSYAVTSIKHVLKYIAKEDW* |
Ga0070700_1003267451 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PEMLRETDSVATALNKMSMGRYRHIPVRKADGTFVVTSIKHVLKYIAKEDW* |
Ga0070694_1014808891 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AIALNKMSIGRFRHIPVQKADGSYCVTSIKHVLKHLARSQW* |
Ga0066681_106606062 | 3300005451 | Soil | EVLSETDSVATALNKMSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW* |
Ga0070685_108453642 | 3300005466 | Switchgrass Rhizosphere | RYRHLPFRKADGSFAVASIQSVLKYIAQEDW*TRPAFPS* |
Ga0070699_1013169051 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AAALNKMSLGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW* |
Ga0070672_1011356151 | 3300005543 | Miscanthus Rhizosphere | KMSMGRYRHIPVVKNDGTYSVTSIKHVLRYIAKETW* |
Ga0070696_1016391461 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DSVAVALNKMSLGGFRHIPVVRKDRSYTVVSIKNVLDYIARADW* |
Ga0066707_103470291 | 3300005556 | Soil | ANPETLHETDSVATALNKMSMGRYRHIPVQKSDGGYSVTSIKHVLKYIAKANW* |
Ga0068855_1020542701 | 3300005563 | Corn Rhizosphere | SLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW* |
Ga0066703_108772491 | 3300005568 | Soil | ETDSVATALNKMSMGRYRHIPVQKSDGTYCVTSIKHVLKYLAKAEW* |
Ga0066706_103375913 | 3300005598 | Soil | PETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW* |
Ga0068859_1005432672 | 3300005617 | Switchgrass Rhizosphere | AALNKMSLGRYRHIPVQRADGTFCVTSIKHVLQYLARSQW* |
Ga0068861_1017812961 | 3300005719 | Switchgrass Rhizosphere | IAAALNKMSLGRYRHLPVIKHDGNYFVTSIKSVLQYIAREDW* |
Ga0068858_1020332871 | 3300005842 | Switchgrass Rhizosphere | LNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW* |
Ga0068862_1005108291 | 3300005844 | Switchgrass Rhizosphere | ETLNETDSVAEALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW* |
Ga0066652_1005344801 | 3300006046 | Soil | SDSVATAVNKMSMGPYRHIPVRRADGSYSVTSIKHVLKYIAREEW* |
Ga0066652_1009089173 | 3300006046 | Soil | NKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKADW* |
Ga0066652_1015195551 | 3300006046 | Soil | MSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKEEWSLAT* |
Ga0075434_1005798742 | 3300006871 | Populus Rhizosphere | PEALRETDSVAVALNKMSMGHYRHIPVQMSDGSYCVTSIRHVLKYLARSQW* |
Ga0075434_1010938302 | 3300006871 | Populus Rhizosphere | ETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW* |
Ga0079217_117235082 | 3300006876 | Agricultural Soil | SVATALSKMSLGRYRHIPVKKIDGTYAVTSIKHVLKYIAKEDW* |
Ga0099793_104471441 | 3300007258 | Vadose Zone Soil | NPEVLDETDSVAEALNKMSLGRYRHIPFKKSDGTYSVASIKSVLKYIAQEDW* |
Ga0099828_110549302 | 3300009089 | Vadose Zone Soil | ATALNKMSMGRYRHIPIRKADGSYSVTSIKHVLKYIAKAEW* |
Ga0105245_116993161 | 3300009098 | Miscanthus Rhizosphere | HERDSVAEALNKMSLGRYRHIPFKKADGTHAAASIKSVLKYIAQEDW* |
Ga0066709_1025174442 | 3300009137 | Grasslands Soil | MSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW* |
Ga0114129_104087725 | 3300009147 | Populus Rhizosphere | SIGRYRHIPVMKNDGSYSVISIKNVLKYIAKENW* |
Ga0114129_125695551 | 3300009147 | Populus Rhizosphere | QLMSTNPEVLLDTDSVAVAVNKMSLGRYRHIPVQKSDGTYCVTSIKHVLKHLARSEW* |
Ga0114129_128654572 | 3300009147 | Populus Rhizosphere | HKMSTGRYRHIPVRKADGSYTVASIKSVLKYIAQEDW* |
Ga0105243_110776271 | 3300009148 | Miscanthus Rhizosphere | NKMSLGRYRHLPILKNDGGYSVTSIKSVLQYIAREDW* |
Ga0105242_115638711 | 3300009176 | Miscanthus Rhizosphere | HERDSVAEALNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW* |
Ga0105248_127788193 | 3300009177 | Switchgrass Rhizosphere | EVLLETDSIAAALNKMSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSQW* |
Ga0105249_100660141 | 3300009553 | Switchgrass Rhizosphere | TALNKMSLGRYRHIPVVKADGTYSVTSIKHVLRYIAKETW* |
Ga0099796_102962672 | 3300010159 | Vadose Zone Soil | PEVLTDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW* |
Ga0134070_101923291 | 3300010301 | Grasslands Soil | ETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW* |
Ga0134088_105107471 | 3300010304 | Grasslands Soil | SDSVATALNKMSMGRYRHIPIQKFDGSYAVTSIKHVLKYIAKEDW* |
Ga0134125_113984891 | 3300010371 | Terrestrial Soil | EALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW* |
Ga0134125_130482141 | 3300010371 | Terrestrial Soil | NAAGIAVKELMSPNPEALDETNSVAEALNKMSLGRYRHLPFRKADGSYAVASIQSVLQYIAQEDW* |
Ga0134124_110294201 | 3300010397 | Terrestrial Soil | SVATALNKMSMGHYRHIPVQNSDGSYCVTSIKHVLKYLAKAEW* |
Ga0134127_131769151 | 3300010399 | Terrestrial Soil | LMSANPEVLRETDSIAVALNKMSLGRYRHIPVQKSDGSYCVTSIKHVLKHLARSQW* |
Ga0134127_134549502 | 3300010399 | Terrestrial Soil | ATALNKMSMGRYRHIPIQRADGTYCVTSIKHVLKYLARSEW* |
Ga0105246_110399721 | 3300011119 | Miscanthus Rhizosphere | TDSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW* |
Ga0120192_100694353 | 3300012021 | Terrestrial | ENPETLHEQDSWATALNRMSTGRYRHIPVRKADGTHMVASINSVLRYIAKEDW* |
Ga0137364_113604462 | 3300012198 | Vadose Zone Soil | LMSIFPEVLSERDSVATAVNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW* |
Ga0137363_111248841 | 3300012202 | Vadose Zone Soil | TALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW* |
Ga0137386_104758772 | 3300012351 | Vadose Zone Soil | VRELMSANPEVLSETDSVATALNKMSMGRYRHSPVQKADGSYSGTSIKHVLKYIAKEEW* |
Ga0137366_111093712 | 3300012354 | Vadose Zone Soil | ALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW* |
Ga0136635_102179661 | 3300012530 | Polar Desert Sand | TLRETDSVASALNKMAMGRYRHVPVARTGGGYSVASIKSVLKYIAQEDW* |
Ga0137373_105587281 | 3300012532 | Vadose Zone Soil | NKMSMGRYRHIPVKKSDGTYCVTSIKHVLKYIAKEDW* |
Ga0137358_109864652 | 3300012582 | Vadose Zone Soil | ETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVIKYIAKAEW* |
Ga0136613_103066541 | 3300012681 | Polar Desert Sand | ALNKMALGRYRHVPIARRDGGYSVASIKSVLKYIAREDW* |
Ga0137398_105789302 | 3300012683 | Vadose Zone Soil | LMSLNPEILSETDSVATAVNKMSMGRYRHIPVRKADGSYSVISIKHVLKYIAKAEW* |
Ga0157303_102868762 | 3300012896 | Soil | TAVNKMSMGRYRHIPVRKADGTYSVTSIKHVLKYIAKAEW* |
Ga0162653_1000585182 | 3300012937 | Soil | IVVAFSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW* |
Ga0137410_114913071 | 3300012944 | Vadose Zone Soil | NKMSLGRYRHIPFQRSDGSYAVASIKSVLKYIAQEDW* |
Ga0126375_102691221 | 3300012948 | Tropical Forest Soil | LRDTDSVATALNKMSLGRYRHIPVRKGDGSYSVTSIKHVLKYIAKAEW* |
Ga0126375_111492472 | 3300012948 | Tropical Forest Soil | SLGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW* |
Ga0164307_119120332 | 3300012987 | Soil | MSIGRYRHIPVQRADGSYCVTSIKHVLKHLARSQW* |
Ga0157378_114777642 | 3300013297 | Miscanthus Rhizosphere | LHETDSVAEALNKMSLGRYRHIPYLKSDGTYAVASIKSVLKYIAQEDW* |
Ga0163162_112462791 | 3300013306 | Switchgrass Rhizosphere | AAALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW* |
Ga0157375_112009391 | 3300013308 | Miscanthus Rhizosphere | MSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSRW* |
Ga0134078_100323171 | 3300014157 | Grasslands Soil | DSVATALNKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKANW* |
Ga0134078_106725122 | 3300014157 | Grasslands Soil | SPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSVTSIKHVLKYIAKANW* |
Ga0157380_125299521 | 3300014326 | Switchgrass Rhizosphere | LNRMSVGRYRHLPVIKSDGSYTVASIKSVLNYIAKEDW* |
Ga0137409_107162551 | 3300015245 | Vadose Zone Soil | MFPEVLSDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW* |
Ga0180081_10875972 | 3300015253 | Soil | MSIGRYRHIPVLKADGSYSVTSIKHVLKYIAKADW* |
Ga0132258_105176344 | 3300015371 | Arabidopsis Rhizosphere | ALNKMAMGRYRHIPVLKNDGNYAVISIKNVLKYIAQENW* |
Ga0184608_103821653 | 3300018028 | Groundwater Sediment | MSLGRYRHIPFKKVDGSYAVASIQSVLKYIAQEDW |
Ga0184618_105052811 | 3300018071 | Groundwater Sediment | ETDSVATAVNKMSMGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW |
Ga0184629_101229582 | 3300018084 | Groundwater Sediment | NPETLHEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIKSVLKYIAKEDW |
Ga0190272_106017141 | 3300018429 | Soil | HESIAFALNKMSIGRYRHIPIEREDGSYTVASIKSVLNYIAQEDW |
Ga0190268_112096311 | 3300018466 | Soil | EHDSVAAALNKMSLGKYRHLPVKRADGSYAVASIKSVLKYIAAEDW |
Ga0190270_119661542 | 3300018469 | Soil | VKELMSANPESLDETSSVAEALNKMSLGRYRHIPFKKADGGYAVASIQSVLRYIAQEDW |
Ga0190273_100315204 | 3300018920 | Soil | NSIAEALNKMSLGRYRHIPFKKADGSYAVASIQSVLKYIAQEDW |
Ga0190273_104089162 | 3300018920 | Soil | KMAMGRYRHVPIVRDDGGYSIASIKSVLKYIAQEDW |
Ga0187893_102650062 | 3300019487 | Microbial Mat On Rocks | LNRMSIGRFRHIPVVKQDGSYGVISIKNVLKYIAREDW |
Ga0190267_109668062 | 3300019767 | Soil | AALNKMAMGRYRHVPIARNDGSYSVASIKSVLRYIAQEEW |
Ga0207670_106381441 | 3300025936 | Switchgrass Rhizosphere | NRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW |
Ga0207711_116708812 | 3300025941 | Switchgrass Rhizosphere | ANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW |
Ga0207711_121112292 | 3300025941 | Switchgrass Rhizosphere | SVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW |
Ga0207667_115798301 | 3300025949 | Corn Rhizosphere | HEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW |
Ga0207677_110909261 | 3300026023 | Miscanthus Rhizosphere | NKMSLGRYRHLPFRKADGSFAVASIQSVLKYIALEDW |
Ga0207648_105651852 | 3300026089 | Miscanthus Rhizosphere | SVAEALNKMSLGRFRHIPFKKADGTYAVASIRSVLKYIAREDW |
Ga0207698_118422492 | 3300026142 | Corn Rhizosphere | EALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW |
Ga0207698_126696052 | 3300026142 | Corn Rhizosphere | TNSVAEALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW |
Ga0209235_10605103 | 3300026296 | Grasslands Soil | KMSLGRYRHIPVTRKDGSYSVTSIKSVLKYIAREDW |
Ga0209471_10863381 | 3300026318 | Soil | SVATAVNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW |
Ga0209471_11230052 | 3300026318 | Soil | DSVATALNKMSMGRYRHIPVLKADGTYAVTSIKHVLRYIAKENW |
Ga0209803_11599731 | 3300026332 | Soil | EMLKETDSVATALNKMSMGRYRHIPVQKSDGSYSVTSIKHVLKYIAKEDW |
Ga0208991_12270131 | 3300027681 | Forest Soil | DSVAAALSKMSLGRYRHLPVARQDGGYSVTSIKSVLKYLAKKDW |
Ga0209485_10198362 | 3300027691 | Agricultural Soil | EYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW |
Ga0209974_103352411 | 3300027876 | Arabidopsis Thaliana Rhizosphere | TALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW |
Ga0209526_101361071 | 3300028047 | Forest Soil | LNKMSMGRYRHIPITHKDGSYSVTSIKNVLQYIGREDW |
Ga0310889_106531251 | 3300032179 | Soil | EVLHEYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW |
Ga0335084_112700452 | 3300033004 | Soil | DLMSVNPEFLRDTDSVATALNKMSMGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW |
Ga0334913_066619_650_757 | 3300034172 | Sub-Biocrust Soil | MAMGRYRHVPVAENDGSYSVTSIKHVLKYIAQEDW |
⦗Top⦘ |