NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086718

Metagenome Family F086718

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086718
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 45 residues
Representative Sequence TALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW
Number of Associated Samples 96
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 97.27 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.273 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(13.636 % of family members)
Environment Ontology (ENVO) Unclassified
(36.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 14.71%    Coil/Unstructured: 61.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00196GerE 12.73
PF00571CBS 2.73
PF00378ECH_1 2.73
PF13692Glyco_trans_1_4 1.82
PF01266DAO 1.82
PF13858DUF4199 1.82
PF00293NUDIX 0.91
PF05016ParE_toxin 0.91
PF13474SnoaL_3 0.91
PF01223Endonuclease_NS 0.91
PF13189Cytidylate_kin2 0.91
PF00348polyprenyl_synt 0.91
PF00999Na_H_Exchanger 0.91
PF01872RibD_C 0.91
PF00881Nitroreductase 0.91
PF08447PAS_3 0.91
PF13946DUF4214 0.91
PF00326Peptidase_S9 0.91
PF09285Elong-fact-P_C 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.91
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.91
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.91
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.91
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.91
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.91
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.91
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.91
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.27 %
UnclassifiedrootN/A2.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17429696All Organisms → cellular organisms → Bacteria → Acidobacteria1781Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104649426All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300000789|JGI1027J11758_12211335All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300002407|C687J29651_10138193All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300004782|Ga0062382_10505960All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005166|Ga0066674_10082689All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300005171|Ga0066677_10552135All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300005187|Ga0066675_11421763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia508Open in IMG/M
3300005340|Ga0070689_100335074All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300005343|Ga0070687_100896251All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300005355|Ga0070671_101535479All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005436|Ga0070713_101482204All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300005439|Ga0070711_100922679All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005440|Ga0070705_100699089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300005441|Ga0070700_100182677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1461Open in IMG/M
3300005441|Ga0070700_100326745All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300005444|Ga0070694_101480889All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300005451|Ga0066681_10660606All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300005466|Ga0070685_10845364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300005518|Ga0070699_101316905All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300005543|Ga0070672_101135615All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium695Open in IMG/M
3300005546|Ga0070696_101639146All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300005556|Ga0066707_10347029All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005563|Ga0068855_102054270All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005568|Ga0066703_10877249All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005598|Ga0066706_10337591All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300005617|Ga0068859_100543267All Organisms → cellular organisms → Bacteria → Acidobacteria1257Open in IMG/M
3300005719|Ga0068861_101781296All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300005842|Ga0068858_102033287All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium568Open in IMG/M
3300005844|Ga0068862_100510829All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300006046|Ga0066652_100534480All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300006046|Ga0066652_100908917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium839Open in IMG/M
3300006046|Ga0066652_101519555All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300006871|Ga0075434_100579874All Organisms → cellular organisms → Bacteria → Acidobacteria1141Open in IMG/M
3300006871|Ga0075434_101093830All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006876|Ga0079217_11723508All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300007258|Ga0099793_10447144All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300009089|Ga0099828_11054930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300009098|Ga0105245_11699316All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium683Open in IMG/M
3300009137|Ga0066709_102517444All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300009147|Ga0114129_10408772All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300009147|Ga0114129_12569555All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300009147|Ga0114129_12865457All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium571Open in IMG/M
3300009148|Ga0105243_11077627All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium810Open in IMG/M
3300009176|Ga0105242_11563871All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium692Open in IMG/M
3300009177|Ga0105248_12778819All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300009553|Ga0105249_10066014All Organisms → cellular organisms → Bacteria → Acidobacteria3330Open in IMG/M
3300010159|Ga0099796_10296267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia684Open in IMG/M
3300010301|Ga0134070_10192329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia746Open in IMG/M
3300010304|Ga0134088_10510747All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300010371|Ga0134125_11398489Not Available763Open in IMG/M
3300010371|Ga0134125_13048214All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium508Open in IMG/M
3300010397|Ga0134124_11029420All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300010399|Ga0134127_13176915All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300010399|Ga0134127_13454950All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300011119|Ga0105246_11039972All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300012021|Ga0120192_10069435All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium664Open in IMG/M
3300012198|Ga0137364_11360446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia527Open in IMG/M
3300012202|Ga0137363_11124884Not Available668Open in IMG/M
3300012351|Ga0137386_10475877All Organisms → cellular organisms → Bacteria → Acidobacteria900Open in IMG/M
3300012354|Ga0137366_11109371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group → Ammoniphilus → Ammoniphilus resinae544Open in IMG/M
3300012530|Ga0136635_10217966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300012532|Ga0137373_10558728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6867Open in IMG/M
3300012582|Ga0137358_10986465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia546Open in IMG/M
3300012681|Ga0136613_10306654All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300012683|Ga0137398_10578930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia775Open in IMG/M
3300012896|Ga0157303_10286876All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium519Open in IMG/M
3300012937|Ga0162653_100058518All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300012944|Ga0137410_11491307All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012948|Ga0126375_10269122All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300012948|Ga0126375_11149247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia643Open in IMG/M
3300012987|Ga0164307_11912033All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300013297|Ga0157378_11477764All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium724Open in IMG/M
3300013306|Ga0163162_11246279All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300013308|Ga0157375_11200939All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300014157|Ga0134078_10032317All Organisms → cellular organisms → Bacteria → Acidobacteria1726Open in IMG/M
3300014157|Ga0134078_10672512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia504Open in IMG/M
3300014326|Ga0157380_12529952All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300015245|Ga0137409_10716255All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia835Open in IMG/M
3300015253|Ga0180081_1087597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300015371|Ga0132258_10517634All Organisms → cellular organisms → Bacteria → Acidobacteria2986Open in IMG/M
3300018028|Ga0184608_10382165All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300018071|Ga0184618_10505281All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300018084|Ga0184629_10122958All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300018429|Ga0190272_10601714All Organisms → cellular organisms → Bacteria → Acidobacteria964Open in IMG/M
3300018466|Ga0190268_11209631All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium627Open in IMG/M
3300018469|Ga0190270_11966154All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300018920|Ga0190273_10031520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2505Open in IMG/M
3300018920|Ga0190273_10408916All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300019487|Ga0187893_10265006All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300019767|Ga0190267_10966806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300025936|Ga0207670_10638144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300025941|Ga0207711_11670881All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300025941|Ga0207711_12111229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia506Open in IMG/M
3300025949|Ga0207667_11579830All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium625Open in IMG/M
3300026023|Ga0207677_11090926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300026089|Ga0207648_10565185All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1046Open in IMG/M
3300026142|Ga0207698_11842249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300026142|Ga0207698_12669605Not Available508Open in IMG/M
3300026296|Ga0209235_1060510All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300026318|Ga0209471_1086338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 891377Open in IMG/M
3300026318|Ga0209471_1123005All Organisms → cellular organisms → Bacteria → Acidobacteria1102Open in IMG/M
3300026332|Ga0209803_1159973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300027681|Ga0208991_1227013All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300027691|Ga0209485_1019836All Organisms → cellular organisms → Bacteria → Acidobacteria1529Open in IMG/M
3300027876|Ga0209974_10335241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300028047|Ga0209526_10136107All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300032179|Ga0310889_10653125All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium546Open in IMG/M
3300033004|Ga0335084_11270045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia734Open in IMG/M
3300034172|Ga0334913_066619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.91%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.91%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.91%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.91%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_038621202088090014SoilVIPSRRRSIQXLRESDSIAAALNSMSIGRYRHIPVQKSDGSYYVTSIKHVLKYLARSEW
INPhiseqgaiiFebDRAFT_10464942623300000364SoilNKMSLGRYRRIPYQKSDGSFSVATIRSVLKYIAQEDW*
JGI1027J11758_1221133513300000789SoilTAVXDLMTSXPEXLHEXDSVAAALNXMSMGRYRHIPVKXHDGSYIVTSIKSVLIYIAKEDW*
C687J29651_1013819313300002407SoilDSVATALNKMYLGRYRHIPVLKGDGSYRVTSIKSVLKYIAGEDW*
Ga0062382_1050596013300004782Wetland SedimentEKDSVATAVNKMSMGRYRHIPVRKTDGSYSVISIKHVLKYIAKAKW*
Ga0066674_1008268933300005166SoilGKDARPDHTTVKELMSPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSFTSIKHVLKYIAKANW*
Ga0066677_1055213513300005171SoilFLRETDSVATAVNKMSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKAEW*
Ga0066675_1142176323300005187SoilSVATALNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW*
Ga0070689_10033507423300005340Switchgrass RhizosphereSADPGTLDESNSVAEALNKMSLGRYRHLPYRKADGSYAVASIQSVLKYIAQEDW*
Ga0070687_10089625123300005343Switchgrass RhizosphereSANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW*
Ga0070671_10153547923300005355Switchgrass RhizosphereANPEILRDTDSVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW*
Ga0070713_10148220423300005436Corn, Switchgrass And Miscanthus RhizosphereALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW*
Ga0070711_10092267913300005439Corn, Switchgrass And Miscanthus RhizosphereLNETDSVATAVNKMSMGRYRHIPIRKADGSYSVISIKHVLKYIAKAEW*
Ga0070705_10069908913300005440Corn, Switchgrass And Miscanthus RhizosphereLNETDSVAAALNKMSLGRYRHIPVARNDGSYAVISIKNVLKYIAQENW*
Ga0070700_10018267713300005441Corn, Switchgrass And Miscanthus RhizosphereTALSKMSLGRYRHIPVVKADGSYAVTSIKHVLKYIAKEDW*
Ga0070700_10032674513300005441Corn, Switchgrass And Miscanthus RhizospherePEMLRETDSVATALNKMSMGRYRHIPVRKADGTFVVTSIKHVLKYIAKEDW*
Ga0070694_10148088913300005444Corn, Switchgrass And Miscanthus RhizosphereAIALNKMSIGRFRHIPVQKADGSYCVTSIKHVLKHLARSQW*
Ga0066681_1066060623300005451SoilEVLSETDSVATALNKMSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW*
Ga0070685_1084536423300005466Switchgrass RhizosphereRYRHLPFRKADGSFAVASIQSVLKYIAQEDW*TRPAFPS*
Ga0070699_10131690513300005518Corn, Switchgrass And Miscanthus RhizosphereAAALNKMSLGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW*
Ga0070672_10113561513300005543Miscanthus RhizosphereKMSMGRYRHIPVVKNDGTYSVTSIKHVLRYIAKETW*
Ga0070696_10163914613300005546Corn, Switchgrass And Miscanthus RhizosphereDSVAVALNKMSLGGFRHIPVVRKDRSYTVVSIKNVLDYIARADW*
Ga0066707_1034702913300005556SoilANPETLHETDSVATALNKMSMGRYRHIPVQKSDGGYSVTSIKHVLKYIAKANW*
Ga0068855_10205427013300005563Corn RhizosphereSLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW*
Ga0066703_1087724913300005568SoilETDSVATALNKMSMGRYRHIPVQKSDGTYCVTSIKHVLKYLAKAEW*
Ga0066706_1033759133300005598SoilPETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW*
Ga0068859_10054326723300005617Switchgrass RhizosphereAALNKMSLGRYRHIPVQRADGTFCVTSIKHVLQYLARSQW*
Ga0068861_10178129613300005719Switchgrass RhizosphereIAAALNKMSLGRYRHLPVIKHDGNYFVTSIKSVLQYIAREDW*
Ga0068858_10203328713300005842Switchgrass RhizosphereLNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW*
Ga0068862_10051082913300005844Switchgrass RhizosphereETLNETDSVAEALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW*
Ga0066652_10053448013300006046SoilSDSVATAVNKMSMGPYRHIPVRRADGSYSVTSIKHVLKYIAREEW*
Ga0066652_10090891733300006046SoilNKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKADW*
Ga0066652_10151955513300006046SoilMSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKEEWSLAT*
Ga0075434_10057987423300006871Populus RhizospherePEALRETDSVAVALNKMSMGHYRHIPVQMSDGSYCVTSIRHVLKYLARSQW*
Ga0075434_10109383023300006871Populus RhizosphereETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0079217_1172350823300006876Agricultural SoilSVATALSKMSLGRYRHIPVKKIDGTYAVTSIKHVLKYIAKEDW*
Ga0099793_1044714413300007258Vadose Zone SoilNPEVLDETDSVAEALNKMSLGRYRHIPFKKSDGTYSVASIKSVLKYIAQEDW*
Ga0099828_1105493023300009089Vadose Zone SoilATALNKMSMGRYRHIPIRKADGSYSVTSIKHVLKYIAKAEW*
Ga0105245_1169931613300009098Miscanthus RhizosphereHERDSVAEALNKMSLGRYRHIPFKKADGTHAAASIKSVLKYIAQEDW*
Ga0066709_10251744423300009137Grasslands SoilMSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW*
Ga0114129_1040877253300009147Populus RhizosphereSIGRYRHIPVMKNDGSYSVISIKNVLKYIAKENW*
Ga0114129_1256955513300009147Populus RhizosphereQLMSTNPEVLLDTDSVAVAVNKMSLGRYRHIPVQKSDGTYCVTSIKHVLKHLARSEW*
Ga0114129_1286545723300009147Populus RhizosphereHKMSTGRYRHIPVRKADGSYTVASIKSVLKYIAQEDW*
Ga0105243_1107762713300009148Miscanthus RhizosphereNKMSLGRYRHLPILKNDGGYSVTSIKSVLQYIAREDW*
Ga0105242_1156387113300009176Miscanthus RhizosphereHERDSVAEALNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW*
Ga0105248_1277881933300009177Switchgrass RhizosphereEVLLETDSIAAALNKMSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSQW*
Ga0105249_1006601413300009553Switchgrass RhizosphereTALNKMSLGRYRHIPVVKADGTYSVTSIKHVLRYIAKETW*
Ga0099796_1029626723300010159Vadose Zone SoilPEVLTDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0134070_1019232913300010301Grasslands SoilETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW*
Ga0134088_1051074713300010304Grasslands SoilSDSVATALNKMSMGRYRHIPIQKFDGSYAVTSIKHVLKYIAKEDW*
Ga0134125_1139848913300010371Terrestrial SoilEALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW*
Ga0134125_1304821413300010371Terrestrial SoilNAAGIAVKELMSPNPEALDETNSVAEALNKMSLGRYRHLPFRKADGSYAVASIQSVLQYIAQEDW*
Ga0134124_1102942013300010397Terrestrial SoilSVATALNKMSMGHYRHIPVQNSDGSYCVTSIKHVLKYLAKAEW*
Ga0134127_1317691513300010399Terrestrial SoilLMSANPEVLRETDSIAVALNKMSLGRYRHIPVQKSDGSYCVTSIKHVLKHLARSQW*
Ga0134127_1345495023300010399Terrestrial SoilATALNKMSMGRYRHIPIQRADGTYCVTSIKHVLKYLARSEW*
Ga0105246_1103997213300011119Miscanthus RhizosphereTDSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW*
Ga0120192_1006943533300012021TerrestrialENPETLHEQDSWATALNRMSTGRYRHIPVRKADGTHMVASINSVLRYIAKEDW*
Ga0137364_1136044623300012198Vadose Zone SoilLMSIFPEVLSERDSVATAVNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0137363_1112488413300012202Vadose Zone SoilTALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW*
Ga0137386_1047587723300012351Vadose Zone SoilVRELMSANPEVLSETDSVATALNKMSMGRYRHSPVQKADGSYSGTSIKHVLKYIAKEEW*
Ga0137366_1110937123300012354Vadose Zone SoilALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW*
Ga0136635_1021796613300012530Polar Desert SandTLRETDSVASALNKMAMGRYRHVPVARTGGGYSVASIKSVLKYIAQEDW*
Ga0137373_1055872813300012532Vadose Zone SoilNKMSMGRYRHIPVKKSDGTYCVTSIKHVLKYIAKEDW*
Ga0137358_1098646523300012582Vadose Zone SoilETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVIKYIAKAEW*
Ga0136613_1030665413300012681Polar Desert SandALNKMALGRYRHVPIARRDGGYSVASIKSVLKYIAREDW*
Ga0137398_1057893023300012683Vadose Zone SoilLMSLNPEILSETDSVATAVNKMSMGRYRHIPVRKADGSYSVISIKHVLKYIAKAEW*
Ga0157303_1028687623300012896SoilTAVNKMSMGRYRHIPVRKADGTYSVTSIKHVLKYIAKAEW*
Ga0162653_10005851823300012937SoilIVVAFSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW*
Ga0137410_1149130713300012944Vadose Zone SoilNKMSLGRYRHIPFQRSDGSYAVASIKSVLKYIAQEDW*
Ga0126375_1026912213300012948Tropical Forest SoilLRDTDSVATALNKMSLGRYRHIPVRKGDGSYSVTSIKHVLKYIAKAEW*
Ga0126375_1114924723300012948Tropical Forest SoilSLGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW*
Ga0164307_1191203323300012987SoilMSIGRYRHIPVQRADGSYCVTSIKHVLKHLARSQW*
Ga0157378_1147776423300013297Miscanthus RhizosphereLHETDSVAEALNKMSLGRYRHIPYLKSDGTYAVASIKSVLKYIAQEDW*
Ga0163162_1124627913300013306Switchgrass RhizosphereAAALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW*
Ga0157375_1120093913300013308Miscanthus RhizosphereMSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSRW*
Ga0134078_1003231713300014157Grasslands SoilDSVATALNKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKANW*
Ga0134078_1067251223300014157Grasslands SoilSPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSVTSIKHVLKYIAKANW*
Ga0157380_1252995213300014326Switchgrass RhizosphereLNRMSVGRYRHLPVIKSDGSYTVASIKSVLNYIAKEDW*
Ga0137409_1071625513300015245Vadose Zone SoilMFPEVLSDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0180081_108759723300015253SoilMSIGRYRHIPVLKADGSYSVTSIKHVLKYIAKADW*
Ga0132258_1051763443300015371Arabidopsis RhizosphereALNKMAMGRYRHIPVLKNDGNYAVISIKNVLKYIAQENW*
Ga0184608_1038216533300018028Groundwater SedimentMSLGRYRHIPFKKVDGSYAVASIQSVLKYIAQEDW
Ga0184618_1050528113300018071Groundwater SedimentETDSVATAVNKMSMGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW
Ga0184629_1012295823300018084Groundwater SedimentNPETLHEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIKSVLKYIAKEDW
Ga0190272_1060171413300018429SoilHESIAFALNKMSIGRYRHIPIEREDGSYTVASIKSVLNYIAQEDW
Ga0190268_1120963113300018466SoilEHDSVAAALNKMSLGKYRHLPVKRADGSYAVASIKSVLKYIAAEDW
Ga0190270_1196615423300018469SoilVKELMSANPESLDETSSVAEALNKMSLGRYRHIPFKKADGGYAVASIQSVLRYIAQEDW
Ga0190273_1003152043300018920SoilNSIAEALNKMSLGRYRHIPFKKADGSYAVASIQSVLKYIAQEDW
Ga0190273_1040891623300018920SoilKMAMGRYRHVPIVRDDGGYSIASIKSVLKYIAQEDW
Ga0187893_1026500623300019487Microbial Mat On RocksLNRMSIGRFRHIPVVKQDGSYGVISIKNVLKYIAREDW
Ga0190267_1096680623300019767SoilAALNKMAMGRYRHVPIARNDGSYSVASIKSVLRYIAQEEW
Ga0207670_1063814413300025936Switchgrass RhizosphereNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW
Ga0207711_1167088123300025941Switchgrass RhizosphereANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW
Ga0207711_1211122923300025941Switchgrass RhizosphereSVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW
Ga0207667_1157983013300025949Corn RhizosphereHEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW
Ga0207677_1109092613300026023Miscanthus RhizosphereNKMSLGRYRHLPFRKADGSFAVASIQSVLKYIALEDW
Ga0207648_1056518523300026089Miscanthus RhizosphereSVAEALNKMSLGRFRHIPFKKADGTYAVASIRSVLKYIAREDW
Ga0207698_1184224923300026142Corn RhizosphereEALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW
Ga0207698_1266960523300026142Corn RhizosphereTNSVAEALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW
Ga0209235_106051033300026296Grasslands SoilKMSLGRYRHIPVTRKDGSYSVTSIKSVLKYIAREDW
Ga0209471_108633813300026318SoilSVATAVNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW
Ga0209471_112300523300026318SoilDSVATALNKMSMGRYRHIPVLKADGTYAVTSIKHVLRYIAKENW
Ga0209803_115997313300026332SoilEMLKETDSVATALNKMSMGRYRHIPVQKSDGSYSVTSIKHVLKYIAKEDW
Ga0208991_122701313300027681Forest SoilDSVAAALSKMSLGRYRHLPVARQDGGYSVTSIKSVLKYLAKKDW
Ga0209485_101983623300027691Agricultural SoilEYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0209974_1033524113300027876Arabidopsis Thaliana RhizosphereTALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0209526_1013610713300028047Forest SoilLNKMSMGRYRHIPITHKDGSYSVTSIKNVLQYIGREDW
Ga0310889_1065312513300032179SoilEVLHEYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0335084_1127004523300033004SoilDLMSVNPEFLRDTDSVATALNKMSMGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW
Ga0334913_066619_650_7573300034172Sub-Biocrust SoilMAMGRYRHVPVAENDGSYSVTSIKHVLKYIAQEDW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.