NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086136

Metagenome / Metatranscriptome Family F086136

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086136
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 39 residues
Representative Sequence MDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL
Number of Associated Samples 84
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.56 %
% of genes near scaffold ends (potentially truncated) 61.26 %
% of genes from short scaffolds (< 2000 bps) 63.06 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.054 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.216 % of family members)
Environment Ontology (ENVO) Unclassified
(25.225 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.838 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.62%    β-sheet: 0.00%    Coil/Unstructured: 59.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF04392ABC_sub_bind 36.04
PF02518HATPase_c 3.60
PF00072Response_reg 2.70
PF12836HHH_3 2.70
PF13683rve_3 2.70
PF12697Abhydrolase_6 2.70
PF00903Glyoxalase 1.80
PF13803DUF4184 1.80
PF02371Transposase_20 1.80
PF08734GYD 1.80
PF13185GAF_2 1.80
PF13191AAA_16 0.90
PF13561adh_short_C2 0.90
PF02744GalP_UDP_tr_C 0.90
PF01695IstB_IS21 0.90
PF00296Bac_luciferase 0.90
PF05221AdoHcyase 0.90
PF13230GATase_4 0.90
PF12840HTH_20 0.90
PF13531SBP_bac_11 0.90
PF07883Cupin_2 0.90
PF04865Baseplate_J 0.90
PF01068DNA_ligase_A_M 0.90
PF04020Phage_holin_4_2 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 36.04
COG3547TransposaseMobilome: prophages, transposons [X] 1.80
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 1.80
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.90
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.90
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.90
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.90
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.90
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.05 %
UnclassifiedrootN/A45.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01CU8MFAll Organisms → cellular organisms → Bacteria504Open in IMG/M
3300000955|JGI1027J12803_102587346All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium825Open in IMG/M
3300000956|JGI10216J12902_106968134All Organisms → cellular organisms → Bacteria2000Open in IMG/M
3300004157|Ga0062590_102602228All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005545|Ga0070695_100885986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales720Open in IMG/M
3300005577|Ga0068857_101191507Not Available737Open in IMG/M
3300006847|Ga0075431_101728819All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria582Open in IMG/M
3300009094|Ga0111539_10054943All Organisms → cellular organisms → Bacteria4735Open in IMG/M
3300009100|Ga0075418_10635654All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300009100|Ga0075418_11833489Not Available660Open in IMG/M
3300009147|Ga0114129_10693132All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300009147|Ga0114129_12688995All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009148|Ga0105243_10070886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2816Open in IMG/M
3300009156|Ga0111538_12290990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium678Open in IMG/M
3300009168|Ga0105104_10859521Not Available530Open in IMG/M
3300009174|Ga0105241_10522320Not Available1062Open in IMG/M
3300009174|Ga0105241_11315961All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009792|Ga0126374_10449305All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300010043|Ga0126380_10069526All Organisms → cellular organisms → Bacteria → Proteobacteria1991Open in IMG/M
3300010043|Ga0126380_10164539Not Available1441Open in IMG/M
3300010043|Ga0126380_11439231All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium607Open in IMG/M
3300010047|Ga0126382_10389168Not Available1083Open in IMG/M
3300010047|Ga0126382_12158439Not Available535Open in IMG/M
3300010359|Ga0126376_12949702All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010360|Ga0126372_10142859All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300010362|Ga0126377_11220362All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300010362|Ga0126377_12457389All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010397|Ga0134124_11260876All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300010400|Ga0134122_10023951All Organisms → cellular organisms → Bacteria → Proteobacteria4596Open in IMG/M
3300012360|Ga0137375_10351533All Organisms → cellular organisms → Bacteria1308Open in IMG/M
3300012363|Ga0137390_10121437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2587Open in IMG/M
3300012511|Ga0157332_1057276All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012922|Ga0137394_10924557All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300012948|Ga0126375_10721031All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300012971|Ga0126369_12656471All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300013100|Ga0157373_10442337All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium935Open in IMG/M
3300013297|Ga0157378_12176722Not Available606Open in IMG/M
3300013306|Ga0163162_10127692All Organisms → cellular organisms → Bacteria2650Open in IMG/M
3300014325|Ga0163163_10801390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1005Open in IMG/M
3300015371|Ga0132258_13533381All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300015374|Ga0132255_101802395All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300017792|Ga0163161_10694981All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300017997|Ga0184610_1054295All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300017997|Ga0184610_1179818All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium702Open in IMG/M
3300018031|Ga0184634_10256663All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium801Open in IMG/M
3300018053|Ga0184626_10357765Not Available593Open in IMG/M
3300018075|Ga0184632_10246377All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300018476|Ga0190274_12847875All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300019269|Ga0184644_1544947All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300020003|Ga0193739_1145609All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium571Open in IMG/M
3300021090|Ga0210377_10447125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium757Open in IMG/M
3300022534|Ga0224452_1048359All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300025901|Ga0207688_10095364All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300025910|Ga0207684_11442127All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300025911|Ga0207654_10950153All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025923|Ga0207681_10087139All Organisms → cellular organisms → Bacteria2221Open in IMG/M
3300025972|Ga0207668_10321089Not Available1285Open in IMG/M
3300026067|Ga0207678_10888333Not Available788Open in IMG/M
3300027880|Ga0209481_10404803Not Available700Open in IMG/M
3300027886|Ga0209486_10176059All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300027909|Ga0209382_11343492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium721Open in IMG/M
3300028589|Ga0247818_11190963All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300028592|Ga0247822_10505616All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300028592|Ga0247822_11183542Not Available637Open in IMG/M
3300030006|Ga0299907_10070088All Organisms → cellular organisms → Bacteria2833Open in IMG/M
3300030006|Ga0299907_10290473All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300030619|Ga0268386_10437624All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300031562|Ga0310886_10725720All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031562|Ga0310886_10774494Not Available602Open in IMG/M
3300031716|Ga0310813_10198521Not Available1643Open in IMG/M
3300031720|Ga0307469_11149920All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031740|Ga0307468_100323016Not Available1135Open in IMG/M
3300031908|Ga0310900_11472194All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300032174|Ga0307470_10298652All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300032174|Ga0307470_11078191All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032180|Ga0307471_101982315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium730Open in IMG/M
3300033550|Ga0247829_10657924Not Available871Open in IMG/M
3300033551|Ga0247830_11058867Not Available647Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.21%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.90%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026013Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_16493702035918004SoilMHRRRFLLTSLAGAVAGPLAVEAQQAGKVARIGYLLGAARE
GPICC_026379002067725002SoilVIDRRRFLLTSVAAALGPPGAIGAQPAEKVYRVGL
JGI1027J12803_10258734623300000955SoilMDRRRFLLTSLAGALAAPLIADAQPAGKVRIIGFLGP
JGI1027J12803_10647918723300000955SoilVIDRRRFLLTSLAGALAAPLAAEAQQAGKVYRVGYLGNF
JGI10216J12902_10696813433300000956SoilMDRRRFLLTSLAGALVAPLAVGAQPSSKVWRIGILALVETRS*
Ga0062590_10260222823300004157SoilMPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGF
Ga0062594_10199181523300005093SoilVIDRRRFLVTSVAGVLAAPLGAAAQQAGRVWRVGTLHTSSAKDE
Ga0073909_1004741423300005526Surface SoilMPHRPGMDRRRFLLTSLAGALAAPLAVDAQPAAKVVPRVGF
Ga0070695_10088598613300005545Corn, Switchgrass And Miscanthus RhizosphereMPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFLS
Ga0068857_10119150723300005577Corn RhizosphereMNRRRFLLTSLAGAITPRASGAQQPGKIWRIGYLSLVSGE
Ga0066903_10562808013300005764Tropical Forest SoilVIDRRRFLLTSLAGTLAMPLTGESQQAERVYRVGLVSLGGD
Ga0082029_148916123300006169Termite NestVDRRRFLRTSLAGALAAPLAAEAQQAGKIARVGVLAG
Ga0075421_10013922373300006845Populus RhizosphereMDRRRFLLTSLAGALAAPFGVGAQQAERVYRVGLVSLGGDP
Ga0075431_10172881913300006847Populus RhizosphereMDRRRFLLTSMAGAVAAPRAAEAQQAAKITRMGYLLRDNDNPAAL
Ga0075433_1051697413300006852Populus RhizosphereVDRRHFFLTSLAGALAAPIAVDAQQTPRPPRVGIVMPTPP
Ga0075433_1072866923300006852Populus RhizosphereMIDRRRFLLTSLTSALAVPVAAGAQQAGKVYRVG*
Ga0111539_1005494313300009094Populus RhizosphereMDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLSVG
Ga0111539_1164176433300009094Populus RhizosphereMDRRRFLLTSLVGALAAPLAAEAQPVDRIYRIGVLGVMPTPRL
Ga0075418_1014537613300009100Populus RhizosphereMIDRRRFLLTSLAGAVAGPLAAGAQAAEKVWRIGLLVPGQPP
Ga0075418_1063565423300009100Populus RhizosphereMGGPGDSPHYPGMDRRRFLLTSLAGAVATPRAAEAQHADRNARIGYLSL
Ga0075418_1183348913300009100Populus RhizosphereMDRRRFLLTSLAGALIMPLGAEGQPGRVYRIGVTVATDIYY
Ga0114129_1020983443300009147Populus RhizosphereMIDRRRFLVTSLAGALTVPLAAGAQQAGKLWRIGFLAGTTVPEFVE
Ga0114129_1022572553300009147Populus RhizosphereVDRRRFLRILLAGAVAAPLAVEAQGADKVAKIGLLT
Ga0114129_1069313213300009147Populus RhizosphereVDRRRFLLTSLAGALPAPLAAGAQQAGKVWRIGFLAGTTVPE
Ga0114129_1260788013300009147Populus RhizosphereMNRRHFLLASLAGALAAPLAAEAQQAGKVYRLGFLAHSEPKTP
Ga0114129_1268899523300009147Populus RhizosphereVDRRRFLLTSLAGVFAAPLAAEAQAAAKVPLIGFVVAGSR
Ga0114129_1303137023300009147Populus RhizosphereMDRRRFFLTSLAWSIAAPLAAEAQEPLRVPRIGMLNVFGPEH
Ga0105243_1007088613300009148Miscanthus RhizosphereVDRRRFLLTSLAWTLAAPFAAAAQHEGKMARVGFLAGARREM
Ga0111538_1229099013300009156Populus RhizosphereMDRRRFLLTSLAGALAAPLAAEAQHPGKIYRIGIL*
Ga0105092_1011205813300009157Freshwater SedimentVIDRRRFLLTSLAGALAAPIVADAQQAGKVYRIGWLPPARHPDPSEPA
Ga0105092_1038090323300009157Freshwater SedimentMDRRRFLPTSLAGALAAPLAAEAQQAGKMVRLGVISA
Ga0105092_1081023713300009157Freshwater SedimentMDRRRFVLTSLGGLLAAPLATAAQQAAKPARIALVCG
Ga0105104_1085952113300009168Freshwater SedimentMDRRRFLLTSLAGALAGPVVAEAQEPGKVYRVGRLSLSDVDSTSIEA
Ga0105241_1052232013300009174Corn RhizosphereVDRRRFLLTSLAGALAAPCFATAQQVGVMYRIGFLPF
Ga0105241_1131596113300009174Corn RhizosphereMPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRI
Ga0126374_1044930533300009792Tropical Forest SoilMERRRFLLTSLAGAVAGPLAARAQQAEKVARPTATF*
Ga0126380_1006952623300010043Tropical Forest SoilMDRRRFLLTSLAGVLAAPLAAGAQPPGKVYRVGFPS*
Ga0126380_1016453913300010043Tropical Forest SoilMDRRRFLLTSLAGALAAPLGAGAQQVARPWRLGYLSA
Ga0126380_1143923113300010043Tropical Forest SoilMDRRRFLLTSLAGAFAGPFAAEAQVAALPRIAVVFSTSP
Ga0126382_1038916833300010047Tropical Forest SoilMDRRRFLLTSLAGAFAAPLAAGAQEARKVYRIGWLAP
Ga0126382_1215843913300010047Tropical Forest SoilMDRRRFLLTSLAGTLAAPLGVGAQQTGKVLMVGTPTT
Ga0126376_1294970213300010359Tropical Forest SoilMDRRRFLLTSLAGALAAPLGAEAQQGAKVRRIGVLSPGPPF
Ga0126372_1014285913300010360Tropical Forest SoilMDRRRFLVTSLAGAVAGPLAARAQQAEKVARPTATF*
Ga0126377_1060897323300010362Tropical Forest SoilMIDRRRFLLTSLAGALVGPLAAGAQQSPKVPRIGYLSAARAE
Ga0126377_1122036213300010362Tropical Forest SoilVDRRRFLLISLTGAVTGPLAAGAQQALKTYRVGFLALAP
Ga0126377_1245738913300010362Tropical Forest SoilMDRRRFLLTSLAGALPTPLTAGAQQAGKVYRIGLIAAAPTAT
Ga0134128_1240438313300010373Terrestrial SoilMDRRRFLLTSLAGAVAAPLAAEGQGTGKVPRIGYVFVTSASDSQSVLD
Ga0134124_1126087613300010397Terrestrial SoilMDRRRFLLTLLAGAFAAPLAAGAQQAREVPRVGFLFYGSA
Ga0134122_1002395133300010400Terrestrial SoilMDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN*
Ga0134123_1094900723300010403Terrestrial SoilVIDRRRFLLTALVTLAGPHAAEAQHAGKMYRVGFLW
Ga0137375_1035153343300012360Vadose Zone SoilMHRRRFLLTSLAGALAGPLAAEAQQAGRVYRIGVLLQGSVAL
Ga0137390_1012143723300012363Vadose Zone SoilMDRRRFLLTSLAGAVAAPLAADTRRLGERARIIVR*
Ga0157332_105727613300012511SoilVDRRRFLLTSLAGALATPLAVKAQQTGKVPKIGWLSDGVRV
Ga0137394_1092455713300012922Vadose Zone SoilVDRRRFLLTSLAGALAGPLAGQAEQAAKVARVGFLTADM
Ga0126375_1072103113300012948Tropical Forest SoilMDRRRFLLTSLAGALPVPLAAEAQQAKNIYVIGILSMAGGPSP
Ga0126369_1265647123300012971Tropical Forest SoilMDRRRFLLTSLAGALATPLAAWAQPTGKVWHIGYLGLGAR
Ga0157373_1044233723300013100Corn RhizosphereMDRRRFLLTSLAGAVAMPFAAGCQQAGKVARIGVLG
Ga0157373_1112188013300013100Corn RhizosphereMMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAV
Ga0157378_1217672213300013297Miscanthus RhizosphereMDRRRFLLTSLAGAVAGPLAAGAQQAGKLPRIGFLSL
Ga0163162_1012769213300013306Switchgrass RhizosphereMDRRRFLLTSLAGALAMPRASEAQQPGRMYRIGVL
Ga0163163_1080139013300014325Switchgrass RhizosphereVDRRRFLLTSLAGAIAGPLVVEAQQAGKVHQIGFLPAG
Ga0132258_1353338133300015371Arabidopsis RhizosphereMDRRRFLLTSLAGALAGPRAAEAQQTAKIWRIGTLHTSPEKDE
Ga0132255_10180239523300015374Arabidopsis RhizosphereMDRRRFLLTSLAGALAAPLTAEAQHADRVRRIGFLGQ
Ga0163161_1069498113300017792Switchgrass RhizosphereMMDRRRFLLTSLVGSLLGAPLAAEAQQARKIPTVGFLVSQ
Ga0184610_105429533300017997Groundwater SedimentVERRRFLLTSLAGALAAPLAAEGQQTAKVARIGYLGPTLAAN
Ga0184610_117981823300017997Groundwater SedimentMDRRRFLLTSLAGPVGAPLAAGAQPAGKVYRVGFV
Ga0184634_1025666313300018031Groundwater SedimentVDRRSFLLTSLAGALAAPFSAEAQPAGKVPRVGVLC
Ga0184638_122329113300018052Groundwater SedimentMDRRRFLLTSLAGAIAAPLAAEAQARKVARIGFLGGNDAS
Ga0184626_1035776523300018053Groundwater SedimentMDRRRFLLTSLACAVAAPIGAGAQQAGRLARVGELVA
Ga0184621_1027001313300018054Groundwater SedimentMDRRRFLLTSLAGALAAPLAAGAQPVSGPARIAWI
Ga0184632_1024637723300018075Groundwater SedimentMDRRRFLLTSLAGALAVPLAAGAQQAGKVPRIGFLSAG
Ga0190274_1284787523300018476SoilMINRRRFLLTSLAGALVGPLAADAQQPAGVARVGLLDP
Ga0184644_154494723300019269Groundwater SedimentMDRRRFLLTPLAGALAVPLGAEAQQRAGKVYRIGYL
Ga0193739_114560923300020003SoilMDRRRFLLTSLAGIAAPLAAEAQHAGTRARIGYLSLASPTATTGD
Ga0210377_1044712513300021090Groundwater SedimentVDRRRFLLTSLAGALAVPLAAEGQQAGKVARIGYLP
Ga0224452_104835913300022534Groundwater SedimentMDRRRFLLTSLAGAFAAPLAVAAQQGSKTARVGVLVAGPPQA
Ga0207688_1009536413300025901Corn, Switchgrass And Miscanthus RhizosphereMTSVMDRRRFLLTSLAVLTAPVSVEAQQPGKIWRIGYL
Ga0207684_1144212723300025910Corn, Switchgrass And Miscanthus RhizosphereVDRRRFLLTSLVGALPLAAGAQQARTIPVVGILHD
Ga0207654_1095015323300025911Corn RhizosphereMDRRRFLLTSLAGILAAPLAAEGQSAGKAYRIGYLGNASA
Ga0207681_1008713933300025923Switchgrass RhizosphereMDRRRFLLTSLAGAVAGPLAVEGQQAGKVATIGFLLNQ
Ga0207668_1032108933300025972Switchgrass RhizosphereMDRRRFLLTSLAGAVATPLGAGAQQAGKIWRIGYLSVVSVE
Ga0208534_100484523300026013Natural And Restored WetlandsMGRLPRRQFLLVSVAFLARSLAAEAQQAGRVYRIGYL
Ga0207678_1088833313300026067Corn RhizosphereMDRRRFLLTSLAGTLIAPLGTEAQQAGKVYRVSFLGNSSAAL
Ga0209684_101669813300027527Tropical Forest SoilMDRRRFVLTSLAGAFAAPLGAGAQQAAKVPRIGFLSAVT
Ga0209481_1040480323300027880Populus RhizosphereMDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL
Ga0209486_1017605923300027886Agricultural SoilMNRRRFLLTSLAGALAAALTAEAQQAGKMFRVGALSSVP
Ga0209382_1134349213300027909Populus RhizosphereMDRRRFLLTSLASALARPPTTEAQQAGRTYRLGTMIPLG
Ga0247818_1119096323300028589SoilMDRRRFLLTSLAGALAGPRAAEAQQAGKVYRIGFLSAIS
Ga0247822_1050561613300028592SoilMMDRRRFLLTSLAGALAAPLAAGAQQTAKIWRIGTLHTSSE
Ga0247822_1118354223300028592SoilMDRRRFLLTSLAGVLAAPRAAGAQQAGKVWRIGYLLLAP
Ga0247822_1172308413300028592SoilMDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFLSLTSP
Ga0299907_1007008843300030006SoilVDRRRFLLTSLAGALTAPPAVAAQQVQRVARVGVLAPR
Ga0299907_1029047313300030006SoilMDRRRFLLTSLAGALAGPLPAEAQQAKVARLGVLL
Ga0268386_1043762423300030619SoilMDRRRFLLTSLAGALAAPLGGEAQARKPVRVGFLSSFPNNP
Ga0308194_1035841113300031421SoilMDRRRFLLTSLAGALAAPLAAGAQQAGKVWRIGTLSLTTPAAGAPNP
Ga0310886_1072572023300031562SoilMPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFL
Ga0310886_1077449423300031562SoilMMDRRRFVLTSLAGTFAEPLAAGAQQAREVPRVGFLF
Ga0310813_1019852113300031716SoilMDRRRFLLTSLAGALAAPLGAGAQQAGKLYRIGLLGGSPP
Ga0307469_1114992013300031720Hardwood Forest SoilVDRRRFLLTSLAGALATPLVAGAQQAEKLPRVGFLSAL
Ga0307468_10032301613300031740Hardwood Forest SoilLTPDPRLPHHPGMDRRRFLLTSLAGALAAPLAVEAQPAEKGKVYRIGFIGP
Ga0310900_1147219413300031908SoilMDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN
Ga0310899_1035576713300032017SoilMERRRFVLTSLAAALAGPLAAVAQQAGKSARIRRLTP
Ga0310895_1031015713300032122SoilMMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAVGSNAT
Ga0307470_1029865213300032174Hardwood Forest SoilMMDRRRFLLTSLAGALVGPLVAEAQQTGKVYRLGFL
Ga0307470_1107819123300032174Hardwood Forest SoilMDRRRFLLTSLAGALAAPLATGAQQAAKISRIAMLV
Ga0307471_10198231533300032180Hardwood Forest SoilMDRRRFLLTSLAGPLAAEAQQAGKVPRVGILVSEPTP
Ga0316626_1129385623300033485SoilMDRRRFLLISLAGALAAPLAAEPQQAGKVYRVGFLAGISPTT
Ga0247829_1038175543300033550SoilMDRRRFLLTSLAGALAAPVGVASQQSVKSPRVGVLR
Ga0247829_1065792413300033550SoilMMDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLS
Ga0247830_1023167743300033551SoilMDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFL
Ga0247830_1105886723300033551SoilMDRRRFLLISLAGALAAPLGAEAQQGGRIHRIGMLETRSTTLN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.