NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086025

Metagenome Family F086025

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086025
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 66 residues
Representative Sequence MQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK
Number of Associated Samples 96
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.47 %
% of genes near scaffold ends (potentially truncated) 18.92 %
% of genes from short scaffolds (< 2000 bps) 72.97 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.586 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(11.712 % of family members)
Environment Ontology (ENVO) Unclassified
(16.216 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(27.928 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.32%    β-sheet: 26.32%    Coil/Unstructured: 67.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF05598DUF772 39.64
PF13751DDE_Tnp_1_6 21.62
PF01797Y1_Tnp 2.70
PF01609DDE_Tnp_1 1.80
PF00932LTD 0.90
PF12850Metallophos_2 0.90
PF07726AAA_3 0.90
PF08238Sel1 0.90
PF14294DUF4372 0.90
PF07589PEP-CTERM 0.90
PF00829Ribosomal_L21p 0.90
PF07587PSD1 0.90
PF16874Glyco_hydro_36C 0.90
PF02542YgbB 0.90
PF03050DDE_Tnp_IS66 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 2.70
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.80
COG3293TransposaseMobilome: prophages, transposons [X] 1.80
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.80
COG5421TransposaseMobilome: prophages, transposons [X] 1.80
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.80
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.80
COG02452C-methyl-D-erythritol 2,4-cyclodiphosphate synthaseLipid transport and metabolism [I] 0.90
COG0261Ribosomal protein L21Translation, ribosomal structure and biogenesis [J] 0.90
COG3436TransposaseMobilome: prophages, transposons [X] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.59 %
UnclassifiedrootN/A14.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101259557All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300001567|Draft_10018763All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales3589Open in IMG/M
3300002988|FeGlu_10514264All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300003432|JGI20214J51088_10492440All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300004153|Ga0063455_100007499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2309Open in IMG/M
3300004282|Ga0066599_101142516All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300004282|Ga0066599_101322086All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300004775|Ga0007798_10010258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2189Open in IMG/M
3300004805|Ga0007792_10246864All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.548Open in IMG/M
3300005213|Ga0068998_10175671Not Available524Open in IMG/M
3300005434|Ga0070709_10155930All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300005435|Ga0070714_100711732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.969Open in IMG/M
3300005829|Ga0074479_10756210All Organisms → cellular organisms → Bacteria2818Open in IMG/M
3300005831|Ga0074471_10974001All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300005921|Ga0070766_11268493All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006174|Ga0075014_100583087All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300006642|Ga0075521_10341855All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006795|Ga0075520_1070587All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300006918|Ga0079216_10108038All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300009075|Ga0105090_10054874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2490Open in IMG/M
3300009090|Ga0099827_10091103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2404Open in IMG/M
3300009167|Ga0113563_10386630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1487Open in IMG/M
3300009179|Ga0115028_11572136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.562Open in IMG/M
3300009502|Ga0114951_10530159All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009506|Ga0118657_11573247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.773Open in IMG/M
3300009645|Ga0116106_1281782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium529Open in IMG/M
3300009789|Ga0126307_10349813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1190Open in IMG/M
3300010341|Ga0074045_10900813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.558Open in IMG/M
3300010412|Ga0136852_10612809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1048Open in IMG/M
3300012350|Ga0137372_10817086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia668Open in IMG/M
3300012683|Ga0137398_10047044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2538Open in IMG/M
3300012917|Ga0137395_10471078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.903Open in IMG/M
3300014160|Ga0181517_10045703All Organisms → cellular organisms → Bacteria2729Open in IMG/M
3300014160|Ga0181517_10307302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.832Open in IMG/M
3300014160|Ga0181517_10575983Not Available565Open in IMG/M
3300014161|Ga0181529_10467559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.672Open in IMG/M
3300014266|Ga0075359_1012540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1132Open in IMG/M
3300014494|Ga0182017_10657168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.636Open in IMG/M
3300014495|Ga0182015_10126703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1750Open in IMG/M
3300014496|Ga0182011_10547599Not Available740Open in IMG/M
3300014498|Ga0182019_10134819All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300014498|Ga0182019_11487556Not Available504Open in IMG/M
3300014501|Ga0182024_10211640All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2638Open in IMG/M
3300014501|Ga0182024_10855171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1102Open in IMG/M
3300014502|Ga0182021_10117193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3094Open in IMG/M
3300014502|Ga0182021_11110702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018952Open in IMG/M
3300014502|Ga0182021_11263881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.889Open in IMG/M
3300014839|Ga0182027_12024169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.551Open in IMG/M
3300017929|Ga0187849_1071818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1536Open in IMG/M
3300017988|Ga0181520_10071512All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3122Open in IMG/M
3300018022|Ga0187864_10397186Not Available594Open in IMG/M
3300018047|Ga0187859_10074649Not Available1785Open in IMG/M
3300018083|Ga0184628_10029601All Organisms → cellular organisms → Bacteria2731Open in IMG/M
3300018083|Ga0184628_10040373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2343Open in IMG/M
3300019786|Ga0182025_1377726All Organisms → cellular organisms → Bacteria3133Open in IMG/M
3300019788|Ga0182028_1516118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1389Open in IMG/M
3300019882|Ga0193713_1016549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2201Open in IMG/M
3300020062|Ga0193724_1008253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2224Open in IMG/M
3300020163|Ga0194039_1018938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2766Open in IMG/M
3300021070|Ga0194056_10015398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.3197Open in IMG/M
3300021473|Ga0194043_1039287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1920Open in IMG/M
3300021602|Ga0194060_10021358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.4014Open in IMG/M
3300025316|Ga0209697_10372741Not Available704Open in IMG/M
3300025616|Ga0208613_1047420Not Available994Open in IMG/M
3300025650|Ga0209385_1119272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.826Open in IMG/M
3300026557|Ga0179587_10106011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1707Open in IMG/M
3300027691|Ga0209485_1062955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.978Open in IMG/M
3300027882|Ga0209590_10056414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2211Open in IMG/M
3300027885|Ga0209450_10770362Not Available695Open in IMG/M
3300027896|Ga0209777_10143641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1975Open in IMG/M
3300027899|Ga0209668_10029393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2802Open in IMG/M
3300027899|Ga0209668_10998025Not Available564Open in IMG/M
3300027911|Ga0209698_10449758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1002Open in IMG/M
3300028556|Ga0265337_1222567Not Available513Open in IMG/M
3300028740|Ga0302294_10010281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2215Open in IMG/M
3300029327|Ga0243509_100909All Organisms → cellular organisms → Bacteria20619Open in IMG/M
3300029922|Ga0311363_10162902All Organisms → cellular organisms → Bacteria2820Open in IMG/M
3300029922|Ga0311363_11228884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.629Open in IMG/M
3300029945|Ga0311330_10477422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1010Open in IMG/M
3300029952|Ga0311346_11513096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.501Open in IMG/M
3300029990|Ga0311336_10168648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1772Open in IMG/M
3300030688|Ga0311345_11259010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.533Open in IMG/M
3300030943|Ga0311366_10664635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.906Open in IMG/M
3300031232|Ga0302323_100154665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2280Open in IMG/M
3300031344|Ga0265316_10836805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.644Open in IMG/M
3300031525|Ga0302326_13305809Not Available541Open in IMG/M
3300031712|Ga0265342_10039384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2872Open in IMG/M
3300031726|Ga0302321_100837021All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1040Open in IMG/M
3300031813|Ga0316217_10034249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.3022Open in IMG/M
3300031873|Ga0315297_10870779Not Available749Open in IMG/M
3300031902|Ga0302322_100415538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1547Open in IMG/M
3300031918|Ga0311367_11246264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.737Open in IMG/M
3300031997|Ga0315278_11320630Not Available702Open in IMG/M
3300031997|Ga0315278_12082909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.528Open in IMG/M
3300032156|Ga0315295_10062274All Organisms → cellular organisms → Bacteria3536Open in IMG/M
3300032173|Ga0315268_11824812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.621Open in IMG/M
3300032256|Ga0315271_10254461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1428Open in IMG/M
3300032256|Ga0315271_10564076All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300032256|Ga0315271_10959370Not Available738Open in IMG/M
3300032256|Ga0315271_11592093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.562Open in IMG/M
3300032275|Ga0315270_10134123All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300032401|Ga0315275_10479401All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300032401|Ga0315275_12345844Not Available555Open in IMG/M
3300032516|Ga0315273_10193122All Organisms → cellular organisms → Bacteria2786Open in IMG/M
3300032562|Ga0316226_1109862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1272Open in IMG/M
3300032893|Ga0335069_10600889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1262Open in IMG/M
3300033418|Ga0316625_100585288All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300033486|Ga0316624_10999156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.754Open in IMG/M
3300033513|Ga0316628_100494651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.1576Open in IMG/M
3300033826|Ga0334847_041923All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.529Open in IMG/M
3300034281|Ga0370481_0024604All Organisms → cellular organisms → Bacteria1790Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment11.71%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen8.11%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.41%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.50%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.60%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.70%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.70%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.70%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.80%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.90%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.90%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.90%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.90%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.90%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.90%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.90%
Wetland SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.90%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.90%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.90%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.90%
Anode BiofilmEngineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001567Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, CanadaEngineeredOpen in IMG/M
3300002988Fe-reducing enrichment culture from wetland sample 1EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004775Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17MEnvironmentalOpen in IMG/M
3300004805Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6MEnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300021070Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13mEnvironmentalOpen in IMG/M
3300021473Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15mEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300025316Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025616Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300029327Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilmEngineeredOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10125955713300000364SoilATRLFVNVHLALAAALDMKPGERLRWQLLNRSDLRLVRLETPAAEKSAKK*
Draft_1001876323300001567Hydrocarbon Resource EnvironmentsMQAEYEMKVRVIHSPQGRAARLFVNIPMPLAGALDIQAGERIRWQLLGRSDMRLVRLEAPSPAKGLKK*
FeGlu_1051426413300002988Wetland SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLQK*
JGI20214J51088_1049244023300003432WetlandMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEVPSPAKGLKR*
Ga0063455_10000749913300004153SoilMKLQVIRSKGRLTRLFVNVPVALASALDMQPGERLRWQLLNRSDLRLIRLGRSAPQKSPKK*
Ga0066599_10114251623300004282FreshwaterMQAEYELKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKS*
Ga0066599_10132208623300004282FreshwaterMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLARSELRLVRLQAPTPAKGLKK*
Ga0007798_1001025823300004775FreshwaterMQAEYEMKVPVIRSKDRAARRFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRLEAPAPARCIKR*
Ga0007792_1024686423300004805FreshwaterMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRLEAPAPARCIKR*
Ga0068998_1017567113300005213Natural And Restored WetlandsLFEMKLQVIRSNGRATRLFVNVPLALAAALDMQPGERLRWQLLNRSDLRLIRLDAAAPQKPRKK*
Ga0070709_1015593023300005434Corn, Switchgrass And Miscanthus RhizosphereMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLNRSDLRLIRLDALAPEKTPKK*
Ga0070714_10071173223300005435Agricultural SoilMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLNRSDLRLIRLDALAPE
Ga0074479_1075621023300005829Sediment (Intertidal)MQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLSRSDLRLVRLEAPSPAKGLKK*
Ga0074471_1097400133300005831Sediment (Intertidal)MQAEYEMKVQVIRSKGRAARLFVNLPMPLAAALDIQAGERIRWQLLDRSDLRLVRLEAPSPAKGLKK*
Ga0070766_1126849323300005921SoilMTTLLGSLYFMQAEYEMKVQVIRSKGRATRLFVNIPMPLAAALDMQAGERVSWQLVDRSDLRLIRLNPPPTKIRSKK*
Ga0075014_10058308713300006174WatershedsMQAEYEMKVQMIRSKGRATRLFVNVPMPLAAALDLQAGERVRWQLLDRSDLRLIR
Ga0075521_1034185523300006642Arctic Peat SoilMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGECIRWQVLGRSDLRLVRLEAPSPAKGLKK*
Ga0075520_107058723300006795Arctic Peat SoilMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGECIRWQVLGRSDLRLVRLEAPSPAKGLKK*
Ga0079216_1010803823300006918Agricultural SoilMQAEYEMKVQIIRSKGRAIRLFVNIPMPLAAALDLEAGERVRWQLLDRSDLRLIRLDPPPASKKPKKGL*
Ga0105090_1005487423300009075Freshwater SedimentMQAEYEMKVQVIRSRGRATRLFVNIPMPLAAALDMAAGERVRWQLLARNDLRLIRLETPQAKKRVKN*
Ga0099827_1009110333300009090Vadose Zone SoilMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLARSELRLVRLEAPTPAKGLKK*
Ga0113563_1038663013300009167Freshwater WetlandsMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDLQAGERVRWQLLSRSDLRLVRIAAPSPAKGLKK*
Ga0115028_1157213613300009179WetlandMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPA
Ga0114951_1053015913300009502FreshwaterMQAEYVMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLNRSDLRLVRLEAPSPARGLKK*
Ga0118657_1157324713300009506Mangrove SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKT*
Ga0116106_128178223300009645PeatlandMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLHGADLRLIRLDAPALQKSSEK*
Ga0126307_1034981323300009789Serpentine SoilMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLDRSDLRLIRLGTLAPEKPSKK*
Ga0074045_1090081323300010341Bog Forest SoilMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEAPSPAKGLKK*
Ga0136852_1061280913300010412Mangrove SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPARGLKK*
Ga0137372_1081708623300012350Vadose Zone SoilMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLDRSDLRLIRLEAPAPKKSSEK*
Ga0137398_1004704433300012683Vadose Zone SoilMQAEYVMKVQVIRSKGRAARVFVNIPMPLAAALDIQPGERIRWQLLGRSDLRLVRLEATSPAKALKR*
Ga0137395_1047107823300012917Vadose Zone SoilMQAHYEMKVQVIRSKGRATRLFVNVPLPLAAALDLQAGERVRWQLLARSDLRLI
Ga0181517_1004570333300014160BogMQAEYEMKMQVIRSKGRAARLFVNIPMPLAAALDIQAGERVRWQLLGRSELHLVRLAAPTPARGLKK*
Ga0181517_1030730223300014160BogMQAEYEMKVQVIRSQDRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLAAPSPAKGLKK*
Ga0181517_1057598313300014160BogAIRLPYKVAVDFMQAEYEMKMQVIRSRGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLEAPTPAKGLKK*
Ga0181529_1046755913300014161BogMQAEYEMKMQVIRSKGRAARLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLAAPTPARGLKK*
Ga0075359_101254013300014266Natural And Restored WetlandsMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEAPSPAKGLKT*
Ga0182017_1065716813300014494FenMRAEYEMKVQVIRSKGRSTRLFVNIPLPLAEALDLQAAEPVRWQLLTRSELRLIRLAPPPVKKRPKK*
Ga0182015_1012670323300014495PalsaMQAEYEMKVQMIRSKGRATRLFVNVPMPLAAALDLQAGERVRWQLLARAELRLIRLEPTPTKKRLKK*
Ga0182011_1054759923300014496FenMQAESEMKVPVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEAVSPAKGLKK*
Ga0182019_1013481923300014498FenMQAESEMKVPVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK*
Ga0182019_1148755623300014498FenMQAEYEMKMQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLKAPSPAKGLKK*
Ga0182024_1021164033300014501PermafrostMQAQLEIKVQMIRSKGRATRLFVNVPLALAAALDLQAGERVRWQLLARSELRLIRLEPPPTKKRLKK*
Ga0182024_1085517113300014501PermafrostMQAEYEMKVQMIRSKGRATRLFVNVPMPLAAALDLQAGERVRWQLLARSDLRLIRLEPSPARKRSKK*
Ga0182021_1011719343300014502FenMQAEYEMKVQVIRSKGRAARVFVNIPMPLAAALDIQAGERVRWQLLERSDLRLVRLEATTPAKGLKK*
Ga0182021_1111070223300014502FenMKVQVIRSEGRAARLFVNIPMPLAAALHLQAGERIRWQVLGRSDLRLVRLEAPSPARGLKK*
Ga0182021_1126388113300014502FenMQAEYEMKVQVIRAEGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLETPSPAKGLKK*
Ga0182027_1202416913300014839FenMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLETPSPAKGLKK*
Ga0187849_107181823300017929PeatlandMQAEYEMKMQVIRAQGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLEAPTPAKGLKK
Ga0181520_1007151223300017988BogMQAEYEMKMQVIRSKGRAARLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLAAPTPARGLKK
Ga0187864_1039718623300018022PeatlandMKLQVIRSKGRATRLFVNVPLALAAALDMQPGERLRWQLLHGADLRLIRLDAPALQKSSE
Ga0187859_1007464913300018047PeatlandIRSKGRATRLFVNVPLALAAALDMKPGEALRWQLINRSDLRLVRLGDSQPGKTSKKCQ
Ga0184628_1002960113300018083Groundwater SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLQK
Ga0184628_1004037323300018083Groundwater SedimentMQAEYEMKVQVIRAKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKR
Ga0182025_137772613300019786PermafrostMQAQLEIKVQMIRSKGRATRLFVNVPLALAAALDLQAGERVRWQLLARSELRLIRLEPPPTKKRLKSSPRFFSRINTIN
Ga0182028_151611833300019788FenMQAESEMKVPVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK
Ga0193713_101654923300019882SoilMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERIRWQLLGRSELRLVRLEAPTPAKGLKK
Ga0193724_100825323300020062SoilMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLAAPTPAKGLKK
Ga0194039_101893823300020163Anoxic Zone FreshwaterMQAEYEMKVPVIRSKDRAARRFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRLEAPAPARCIKR
Ga0194056_1001539823300021070Anoxic Zone FreshwaterMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRLEAPAPARCIKR
Ga0194043_103928713300021473Anoxic Zone FreshwaterMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRL
Ga0194060_1002135833300021602Anoxic Zone FreshwaterMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMDIQAGERVRWQLLGRSDLRLVRLEAPAPARCIKR
Ga0209697_1037274113300025316Freshwater Lake HypolimnionVPGIRSKDRAARLFVNIPMLLTAAMDIQAGERVRWQLLGRSDLRLVRLKAPAPARCIKR
Ga0208613_104742013300025616FreshwaterRTNQQAQLLDRLALKAMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMAIQAGERVRWQRLGRSDLRLVRLEAPAPARCIKR
Ga0209385_111927223300025650Arctic Peat SoilMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGECIRWQVLGRSDLRLVRLEAP
Ga0179587_1010601123300026557Vadose Zone SoilMQAEYEMKVQVIRSKGRAARVFVNIPMPLAAALDIQPGERIRWQLLGRSDLRLVRLEATSPAKALKR
Ga0209485_106295523300027691Agricultural SoilMQAEYEMKVQIIRSKGRAIRLFVNIPMPLAAALDLEAGERVRWQLLDRSDLRLIRLDPPPASKKPKKGL
Ga0209590_1005641433300027882Vadose Zone SoilMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLARSELRLVRLEAPTPAKGLKK
Ga0209450_1077036223300027885Freshwater Lake SedimentMQAEYEMKVQVIRAKGRAARLFVNIPMPLAAALDLQAGELIRWQVLGRSDLRLVRLEAPSPAKGLKS
Ga0209777_1014364113300027896Freshwater Lake SedimentMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK
Ga0209668_1002939323300027899Freshwater Lake SedimentMQAEYEMKVPVIRSKDRAARLFVNIPMLLTAAMDIQAGERVRWQPLGRSDLRLVRLEAPAPARCIKR
Ga0209668_1099802523300027899Freshwater Lake SedimentMQAQYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPARGLKK
Ga0209698_1044975823300027911WatershedsMQAEYEMKVQMIRSKGRATRLFVNVPMPLAAALDLQAGERVRWQLLDRSDLRLIRLEAPPAKKTSKK
Ga0265337_122256723300028556RhizosphereMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPMKGLKK
Ga0302294_1001028113300028740FenMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRDELRLVRLEAPTPEKGLKK
Ga0243509_100909123300029327Anode BiofilmMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAQGLKK
Ga0311363_1016290243300029922FenMQAEFEMKVQMIRSKGRATRLFVNIPLPLAAALDLEAGERVRWQLLDRSDLRLIRLA
Ga0311363_1122888413300029922FenMQAQYEMKMQVIRSKGRAARLFINIPMPLAAALDIQAGEPVRWQLLGRSELRLVRLAPPTPARGLKK
Ga0311330_1047742213300029945BogMQAEFEMKVQMIRSKGRATRLFVNIPLPLAAALDLEAGERVRWQLLDRSDLRLIRL
Ga0311346_1151309613300029952BogMQAEFEMKVQMIRSKGRATRLFVNVPLPLAAALDLQAGEPVRWQLLARSELRLIR
Ga0311336_1016864823300029990FenMQAEYEMKMQVIRSKGRASRLFINIPMPLAAALDIQAGERVRWQLLGRSELRLVRLEAPTPAKGLKK
Ga0311345_1125901013300030688BogMQAEFEMKVQMIRSTGRATRLFVNIPLPLAAALDLEAGERVRWQLLDRSDLRLIRLA
Ga0311366_1066463523300030943FenMRLLVTVAHCFMQADFEMKVQVIRSKGRAARVFVNIPIPLAAALDIRAGERVRWQLLGRSDLRLVRLEGYTPARGLKKG
Ga0302323_10015466513300031232FenMQAEYEVKMQVIRSKGRATRLFVNIPMPLAAALDIQAGERVRWQLLGRDELRLVRLEAPTPEKGLKK
Ga0265316_1083680523300031344RhizosphereMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGECIRWQVLGRSDLRLVRLEAPSPAKGLKK
Ga0302326_1330580923300031525PalsaMQAEFEMKVQMNRSQGRATRLFVNVSLPLAAALELQAGERVRWQVLARSELRLIRLQPPPTKKRLKK
Ga0265342_1003938413300031712RhizosphereMQAEYEMKVQVIRSRGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEAPSPAKGLKK
Ga0302321_10083702123300031726FenMQAEYEMKVQVIRSKGRAARVFVNIPMPLAAALDIQAGEHVRWQLLDRSDLRLVRLQAATPARGLKK
Ga0316217_1003424923300031813FreshwaterMQAQYEMKMQVIRSKGRAARLFVNLPMPLAAALDIQAGERVRWQLLGRSELRLVRLAAPSPARGLKN
Ga0315297_1087077923300031873SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK
Ga0302322_10041553823300031902FenMQAEYEMKVQVIRSKGRAARVFVNIPMPLAAALDIQAGERVRWQLLERSDLRLVRLEATTPAKGLKK
Ga0311367_1124626423300031918FenMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLAAPSPAKGLKR
Ga0315278_1132063023300031997SedimentMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLEALTPAKGLKK
Ga0315278_1208290913300031997SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKK
Ga0315295_1006227423300032156SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLEAPTPARGLKK
Ga0315268_1182481223300032173SedimentMQAEYEVKMQMIRSKGRATRLFVNIPMPLAAALDLQAGERVRWQLISRDHLRLVRLEAPSPARGLKK
Ga0315271_1025446123300032256SedimentMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDVQAGERIRWQLLGRSDLRLVRLEAPSPARGLKK
Ga0315271_1056407623300032256SedimentMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIRWQLLGRSDLRLVRLEAPSPAKGLKS
Ga0315271_1095937013300032256SedimentMRLLVTVPHCFMQADFEMKVQVIRSKGRAARVFVNIPIPLAAALDIRAGERVRWQLLGRSELRLVRLEGPTPAKGLKKS
Ga0315271_1159209323300032256SedimentMQAEYEMKVQVIRAQGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLET
Ga0315270_1013412323300032275SedimentMKLLGIRSQSRATRLFVNVPLALAAALDMQPGERLRWQLLNRSDLRLIRLEVPAPEKPSR
Ga0315275_1047940123300032401SedimentMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDMQAGERVRWQLLGRSELRLVRLEAPTPAKGLKK
Ga0315275_1234584413300032401SedimentNKTMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEAPSPAKGLKK
Ga0315273_1019312213300032516SedimentMQAEYEMKMQVIRSKGRASRLFVNIPMPLAAALDIQAGERVRWQLLGRSELRLVRLE
Ga0316226_110986223300032562FreshwaterMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERTRWQLLGRSDLRLVRLEAPSPAKGLKK
Ga0335069_1060088913300032893SoilMKVQVIRAKGRAARLFVNIPMPLAAALDLQAGELIRWQVLGRSDLRLVRLEAPNPT
Ga0316625_10058528823300033418SoilMQAQYEMKVQVIRSKGRAARLFVNIPMPLAAALDIQAGERIRWQLLGRSDLRLVRLDAPSPAKGLKR
Ga0316624_1099915613300033486SoilMQAKYEMKVQVIRSKGRAVRMFVNVPMPLAAALDLQAGERVRWQLLGRAELRLIRLEAPAPG
Ga0316628_10049465113300033513SoilMMQAEYEMKVQVIRSKGRATRMFVNIPMPLAAALNFQAGERVSWQLVDRSDLRLIRLAAPPAKKRAKSK
Ga0334847_041923_43_2463300033826SoilMQAEYEMKVQVIRSEGRAARLFVNIPMPLAAALDLQAGERIQWQVLGRSDLRLVRLEAPSPAKGLKQ
Ga0370481_0024604_631_8613300034281Untreated Peat SoilMQAEYEMKVQVIRSKGRAARLFVNIPMPLAAALDLQAGERIRWQVLGRSDLRLVRLEANGTKTRKGESFCLWSGSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.