NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085988

Metagenome / Metatranscriptome Family F085988

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085988
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 37 residues
Representative Sequence MLEWKPRLIVLVVGLAAVASSMGIVFWPINFGWGAW
Number of Associated Samples 95
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.98 %
% of genes near scaffold ends (potentially truncated) 20.72 %
% of genes from short scaffolds (< 2000 bps) 90.09 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.072 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.315 % of family members)
Environment Ontology (ENVO) Unclassified
(30.631 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.144 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.25%    β-sheet: 0.00%    Coil/Unstructured: 68.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF00877NLPC_P60 52.25
PF00990GGDEF 5.41
PF01966HD 1.80
PF05977MFS_3 0.90
PF02786CPSase_L_D2 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 52.25
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.07 %
UnclassifiedrootN/A27.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459022|GZEQPF102IH5J9All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
2199352024|deeps_contig77085.46325All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300000956|JGI10216J12902_107479304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2927Open in IMG/M
3300001535|A3PFW1_10578104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300001664|P5cmW16_1060919Not Available642Open in IMG/M
3300004479|Ga0062595_100071851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1704Open in IMG/M
3300004479|Ga0062595_100501949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium911Open in IMG/M
3300004479|Ga0062595_100893499Not Available747Open in IMG/M
3300005179|Ga0066684_10257611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1147Open in IMG/M
3300005184|Ga0066671_10358376All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300005336|Ga0070680_100172791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1819Open in IMG/M
3300005339|Ga0070660_100424805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1101Open in IMG/M
3300005435|Ga0070714_101213535All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005530|Ga0070679_101671609All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005538|Ga0070731_10017374All Organisms → cellular organisms → Bacteria5060Open in IMG/M
3300005542|Ga0070732_10224945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300005547|Ga0070693_100413656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300005553|Ga0066695_10681468All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005555|Ga0066692_10185163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300005563|Ga0068855_100815130All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300005578|Ga0068854_100505246All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300005764|Ga0066903_100099984All Organisms → cellular organisms → Bacteria3913Open in IMG/M
3300005764|Ga0066903_101168966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1426Open in IMG/M
3300005896|Ga0075282_1028614Not Available744Open in IMG/M
3300005896|Ga0075282_1049588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300006028|Ga0070717_10848600Not Available831Open in IMG/M
3300006028|Ga0070717_11231110All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006032|Ga0066696_10233225All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300006046|Ga0066652_100022092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4395Open in IMG/M
3300006175|Ga0070712_100513476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1006Open in IMG/M
3300006796|Ga0066665_11003602Not Available640Open in IMG/M
3300006852|Ga0075433_10886803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300007820|Ga0104324_130765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2502Open in IMG/M
3300009012|Ga0066710_101291789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1132Open in IMG/M
3300009012|Ga0066710_102913435Not Available671Open in IMG/M
3300009038|Ga0099829_10199491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1618Open in IMG/M
3300009137|Ga0066709_100125863All Organisms → cellular organisms → Bacteria3214Open in IMG/M
3300009551|Ga0105238_11306773Not Available751Open in IMG/M
3300010154|Ga0127503_10179737Not Available759Open in IMG/M
3300010333|Ga0134080_10231794Not Available809Open in IMG/M
3300010335|Ga0134063_10449581Not Available638Open in IMG/M
3300010337|Ga0134062_10771289All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010396|Ga0134126_10804455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300010396|Ga0134126_11658764All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300010396|Ga0134126_12522923Not Available559Open in IMG/M
3300010858|Ga0126345_1161896Not Available614Open in IMG/M
3300010861|Ga0126349_1260911Not Available530Open in IMG/M
3300010866|Ga0126344_1077171Not Available506Open in IMG/M
3300011271|Ga0137393_10342625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300012199|Ga0137383_10919079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300012200|Ga0137382_10298799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1123Open in IMG/M
3300012201|Ga0137365_10781791Not Available697Open in IMG/M
3300012206|Ga0137380_10446436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1144Open in IMG/M
3300012208|Ga0137376_10628592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300012359|Ga0137385_10696954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300012362|Ga0137361_10779490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300012923|Ga0137359_11693439Not Available520Open in IMG/M
3300012923|Ga0137359_11738371Not Available511Open in IMG/M
3300012924|Ga0137413_10836813Not Available710Open in IMG/M
3300012927|Ga0137416_12250198All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012930|Ga0137407_11084816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium759Open in IMG/M
3300012931|Ga0153915_11795910Not Available717Open in IMG/M
3300012931|Ga0153915_12118705Not Available658Open in IMG/M
3300013100|Ga0157373_10338773All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300013104|Ga0157370_11381318Not Available634Open in IMG/M
3300013105|Ga0157369_11899837Not Available604Open in IMG/M
3300013105|Ga0157369_12341867Not Available541Open in IMG/M
3300013307|Ga0157372_12053923All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300013832|Ga0120132_1129137All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300013832|Ga0120132_1155342Not Available503Open in IMG/M
3300014058|Ga0120149_1166692All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300014150|Ga0134081_10415247Not Available508Open in IMG/M
3300015089|Ga0167643_1015920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1132Open in IMG/M
3300015371|Ga0132258_10350050All Organisms → cellular organisms → Bacteria3652Open in IMG/M
3300017994|Ga0187822_10320614Not Available552Open in IMG/M
3300018468|Ga0066662_10501871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1105Open in IMG/M
3300018468|Ga0066662_10610336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300019888|Ga0193751_1027429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2716Open in IMG/M
3300021344|Ga0193719_10215595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300021363|Ga0193699_10123555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1056Open in IMG/M
3300021478|Ga0210402_11034786All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300025544|Ga0208078_1031479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1166Open in IMG/M
3300025898|Ga0207692_10673808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300025912|Ga0207707_10086505All Organisms → cellular organisms → Bacteria2739Open in IMG/M
3300025912|Ga0207707_10182230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1833Open in IMG/M
3300025912|Ga0207707_10354306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1264Open in IMG/M
3300025919|Ga0207657_10366526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1135Open in IMG/M
3300025929|Ga0207664_11425008All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300025998|Ga0208651_1014269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300026538|Ga0209056_10239518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1297Open in IMG/M
3300026550|Ga0209474_10592870All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300026555|Ga0179593_1131603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2533Open in IMG/M
3300027546|Ga0208984_1042320Not Available966Open in IMG/M
3300027738|Ga0208989_10053223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1398Open in IMG/M
3300027869|Ga0209579_10150893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1239Open in IMG/M
3300027882|Ga0209590_10371627All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300027903|Ga0209488_10524268Not Available866Open in IMG/M
3300028047|Ga0209526_10093797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2112Open in IMG/M
3300028828|Ga0307312_10099614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1800Open in IMG/M
3300028884|Ga0307308_10552446Not Available552Open in IMG/M
3300030917|Ga0075382_11686831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300030981|Ga0102770_11238013Not Available555Open in IMG/M
3300031057|Ga0170834_103263435All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300031446|Ga0170820_10878006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300031469|Ga0170819_17918374Not Available587Open in IMG/M
3300031962|Ga0307479_10708888All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300031996|Ga0308176_11652717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300032180|Ga0307471_100307456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1676Open in IMG/M
3300032180|Ga0307471_102887687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300034268|Ga0372943_0911650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300034384|Ga0372946_0647686All Organisms → cellular organisms → Bacteria510Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.41%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.70%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.70%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.70%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.70%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.70%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.90%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.90%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459022Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007820Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025998Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA2_026150902170459022Grass SoilMLEWKPRLIILVVGLAVLASSMGFEFWPINFGWGS
deeps_005576502199352024SoilMLEWNPRLIALVVGLASLAASLGWIFPPTNFGWGAW
JGI10216J12902_10747930423300000956SoilMLEWKPRLIFLVVGLASFAMSFGLLFVPVNFGWDFG*
A3PFW1_1057810423300001535PermafrostWRETMLEWKPRLIVLVVGLAAVASSMGIVFWPINFGWGAW*
P5cmW16_106091923300001664PermafrostMLEWKPRLIVLVVGLAAMASSMGIVFWPINFGWGAW*
Ga0062595_10007185123300004479SoilMLEWKPRLIVLVVGIAVLAASLNGMLFVFAPDNFGWGAW*
Ga0062595_10050194923300004479SoilMLEWKPRLIVLVVGIAVIAASLDGLFAVFAPGNFGWGAW*
Ga0062595_10089349913300004479SoilCLASNLLWREHMLEWRPRLIVLVMALASLASALGWLFSPENFGWGAW*
Ga0066684_1025761123300005179SoilMLEWKPRLIVLVLGIAVIAASLSGMFGLFAPGNFGWGAW*
Ga0066671_1035837623300005184SoilMLEWKPRLFAIVVGLAAVAASLSGMLAYFVPGNFGWGAW*
Ga0070680_10017279123300005336Corn RhizosphereMLEWKPRLFVLVVGIAVLAASLNGMFALFAPGNFGWGAW*
Ga0070660_10042480523300005339Corn RhizosphereMLEWKPRLFVLVVGIAVLAASLNGMLFVFAPDNFGWGAW*
Ga0070714_10121353523300005435Agricultural SoilMLEWKPRLIVLVVVTAVFAAALNGMFFLFDPSNFGWGAW*
Ga0070679_10167160923300005530Corn RhizosphereMLEWKPRLIVLVVGIAVLAASLNGMFGLLAPGNFGWGAW*
Ga0070731_1001737423300005538Surface SoilMLEWKPRLIVLVLGIAVIAASLSGFFVMFDPSNFGWGAW*
Ga0070732_1022494523300005542Surface SoilTMLEWKPRLIVLVVGLAALASAAGTVFGPGNFGWGAW*
Ga0070693_10041365613300005547Corn, Switchgrass And Miscanthus RhizosphereRNRMLEWNPRLVALVAGLAALALSFGWVFSPDNFGWGAW*
Ga0066695_1068146823300005553SoilMLEWKPRLIVLVIGLAVLASSMGFVFDPINFGWGNW*
Ga0066692_1018516323300005555SoilMLEWRPRLIVLVVGVAALASSIGFVFLPGNFGWGLW*
Ga0068855_10081513023300005563Corn RhizosphereMLEWNPRLIALVVGLASLAASLGWIFPPTNFGWGAW*
Ga0068854_10050524623300005578Corn RhizosphereMLEWNPRLVALIVIVAAFAASFGWVVSAGNFGWGAW*
Ga0066903_10009998423300005764Tropical Forest SoilMLEWKPRLIALVVGLLAIAAAMGLTFPPINFGWGAW*
Ga0066903_10116896623300005764Tropical Forest SoilMLEWKPRLIALVVGLLAIAATMGLTFPPINFGWGAW*
Ga0075282_102861413300005896Rice Paddy SoilMLEWKPRLIVLVVGLAALAASLGLTFPPINFGWGAW*
Ga0075282_104958823300005896Rice Paddy SoilMLEWKPRLVVLVVGLVAFAASLGFSLGPGNFNWGAW*
Ga0070717_1084860013300006028Corn, Switchgrass And Miscanthus RhizosphereMLEWKPRLIVLVVGIAVLAASLNGMFALFAPGNFGWGAW*
Ga0070717_1123111013300006028Corn, Switchgrass And Miscanthus RhizosphereMLEWKPRLIVLVVGLAAVASSMGIVFWPINFGWGVW*
Ga0066696_1023322523300006032SoilMLEWNPRLVALVVGVIAAAAALGFDFSPSNFGWGAW*
Ga0066652_10002209263300006046SoilMLEWNPRLVALVVGVVAFAASLGYDFWPSNFGWGAW*
Ga0070712_10051347623300006175Corn, Switchgrass And Miscanthus RhizosphereMLEWKPRLIVLVVGLIVLASTMGFVFEPINFGWGNW*
Ga0066665_1100360223300006796SoilMLEWKPRLIVLVVVVASLAAAYGWIFTAGNFGWDAW*
Ga0075433_1088680323300006852Populus RhizosphereMLEWNPRLAALVIGVVALAASLGFNFWPSNFGWGAW*
Ga0104324_13076563300007820SoilMLEWKPRLFILVVGLAAIASTMGIEFWPINFGWGAW*
Ga0066710_10129178923300009012Grasslands SoilMLEWKPRLIVLVIGLAVLASSMGFVFDPINFGWGNW
Ga0066710_10291343513300009012Grasslands SoilMLEWNPRLVVLVAGLASLAASLGWILSPSNFGWGAW
Ga0099829_1019949123300009038Vadose Zone SoilMLEWKPRLIVLVVGLIVLASSMGFVFEPINFGWGNW*
Ga0066709_10012586323300009137Grasslands SoilMLEWKPRLIVLVVVVASLAAAYGWIFTAGKFGWDAW*
Ga0105238_1130677313300009551Corn RhizosphereNSMLEWNPRLIALVVGLASLAASLGWIFPPTNFGWGAW*
Ga0127503_1017973713300010154SoilMLEWKPRLIVLVVAVVGLAASMGFDFWPINFGWGSW*
Ga0134080_1023179423300010333Grasslands SoilSGGNMLEWKPRLIVLVVVVASLAAAYGWIFTAGNFGWDAW*
Ga0134063_1044958123300010335Grasslands SoilVLVLWRERMLEWNPRLVVLVAGLASLAASLGWILSPSNFGWGAW*
Ga0134062_1077128923300010337Grasslands SoilMLEWNPRLVVLVAGLASLAASLGWILSPSNFGWGAW*
Ga0134126_1080445513300010396Terrestrial SoilMLEWKPRLIVLVVVIAVIAASLNGMFAFFLPGNFGWGAW*
Ga0134126_1165876423300010396Terrestrial SoilMLEWNPRLVALIVIVAAFAASFGWIVSAGNFGWGAW*
Ga0134126_1252292313300010396Terrestrial SoilMLEWKPRLIVLVVGLAVMASAMGIVFSPINFGWGSF*
Ga0126345_116189613300010858Boreal Forest SoilLMLWRETMLEWKPRLIVLVVGLAALASSMGIVFWPINFGWGAW*
Ga0126349_126091123300010861Boreal Forest SoilMLEWKPRLIVLVVGLAAVASSMGIVFWPINFGWGAW*
Ga0126344_107717123300010866Boreal Forest SoilMLEWKPRLIVLVVGLAVMASSMGILFWPINFGWGNF*
Ga0137393_1034262523300011271Vadose Zone SoilMLEWKPRLIVLVVGLAVLASSMGFVFEPINFGWGNW*
Ga0137383_1091907923300012199Vadose Zone SoilMLEWKPRLIVLVIGLAVLASTMGFVFEPINFGWGNW*
Ga0137382_1029879923300012200Vadose Zone SoilMLEWKPRLIVLVVGLAVVASSMGIVFWPINFGWGVW*
Ga0137365_1078179123300012201Vadose Zone SoilMLEWRPRLIVLVVALASLASALGWLFSPDNFGWGAW*
Ga0137380_1044643623300012206Vadose Zone SoilMLEWKPRLIVLVVGLAVLAASMGFVFEPINFGWGNW*
Ga0137376_1062859223300012208Vadose Zone SoilGNMLEWKPRLIVLVVVVASLAAAYGWIFTAGNFGWDAW*
Ga0137385_1069695423300012359Vadose Zone SoilMLEWKPRLAVLLAGLATVAASLGWILEPSNFGWGAW*
Ga0137361_1077949023300012362Vadose Zone SoilMLEWKPRLIVLVVGLAAVASSMGFVFGPINFGWGVW*
Ga0137359_1169343923300012923Vadose Zone SoilMLEWKPRLIVLVVGLAVLASSLGIMFWPINFGWGDF*
Ga0137359_1173837113300012923Vadose Zone SoilTMLEWKPRLIVLVAGLAALASSAGTLFGPGNFGWGLF*
Ga0137413_1083681323300012924Vadose Zone SoilMLEWNPRLVALVVGLASLAASLGWIFPPTNFGWGAW*
Ga0137416_1225019813300012927Vadose Zone SoilMLEWKPRLIVLVVGLAVMASSMGIMFLPINFGWGVW*
Ga0137407_1108481623300012930Vadose Zone SoilMLEWKPRLIVLVVGLAVVASSMGIVFWPINFGWGNW*
Ga0153915_1179591013300012931Freshwater WetlandsMLEWNPRLIALVAGLALLATALGFVFSPENFGWGAW*
Ga0153915_1211870523300012931Freshwater WetlandsMLEWNPRLIALLVGLASLAASLSFIFPPTNFGWGAW*
Ga0157373_1033877323300013100Corn RhizosphereMLEWNPRLIALVVGLASLAAALGWIFPPTNFGWGAW*
Ga0157370_1138131813300013104Corn RhizosphereMLEWNPRLIALMVGLASLAASLGWIFPPTNFGWGAW*
Ga0157369_1189983713300013105Corn RhizosphereWKPRLIVLVVGVAVIAASLDGLFAVFAPGNFGWGAW*
Ga0157369_1234186723300013105Corn RhizosphereMLEWNPRLVALVAGLAALALSFGWVFSPDNFGWGAW*
Ga0157372_1205392323300013307Corn RhizosphereMLEWNPRLIALVVGLSSLAASLGWIFPPTNFGWGAW*
Ga0120132_112913723300013832PermafrostMLEWKPRLIVLVVGLAALASSMGIVFWPINFGWGNW*
Ga0120132_115534223300013832PermafrostLEWKPRLIVLVVGLAAFAASSGFVFGPVNFGWGSW*
Ga0120149_116669223300014058PermafrostMLEWKPRLIVLVVGLAVMASSMGIVFWPINFGWGAW*
Ga0134081_1041524723300014150Grasslands SoilMLEWNPRLVVLVAGLASLAASLVWILSPSNFGWGAW*
Ga0167643_101592023300015089Glacier Forefield SoilMLEWKPRLIVLVVGLAAFAASSGFVFGPVNFGWGSW*
Ga0132258_1035005033300015371Arabidopsis RhizosphereMLEWKPRLIALVVGLLALAASLGLTFPPVNFGWGAW*
Ga0187822_1032061423300017994Freshwater SedimentPSALEGITMLEWKPRLIVLVVGLAALASAAGTVFGPGNFGWGAW
Ga0066662_1050187113300018468Grasslands SoilMLEWNPRLVALVIGLASVIAMFSGWIVFAGNFGWGAY
Ga0066662_1061033623300018468Grasslands SoilMLEWKPRLIVLVVGLAVMASSMGIMFLPINFGWGVW
Ga0193751_102742953300019888SoilMLEWKPRLIVLVVGLAVVASSMGIEFWPINFGWGNW
Ga0193719_1021559523300021344SoilMLEWRPRLIVLVVALASLASALGWFFSPDNFGWGA
Ga0193699_1012355523300021363SoilMLEWNPRLVALVVGLASLAASLGWIFPPTNFGWGAW
Ga0210402_1103478623300021478SoilMLEWKPRLIVLVVGLAVMASSMGIVFWPINFGWGNF
Ga0208078_103147923300025544Arctic Peat SoilMLEWKPRLFVLVVGLAAIASTMGIEFWPINFGWGAW
Ga0207692_1067380823300025898Corn, Switchgrass And Miscanthus RhizosphereMLELKPRLIVLVVVTAVFAAALNGMFFLFDPSNFGWGAW
Ga0207707_1008650523300025912Corn RhizosphereMLEWNPRLVALIVIVAAFAASFGWVVSAGNFGWGAW
Ga0207707_1018223023300025912Corn RhizosphereMLEWKPRLFVLVVGIAVLAASLNGMFALFAPGNFGWGAW
Ga0207707_1035430623300025912Corn RhizosphereMLEWNPRLVALVAGLAALALSFGWVFSPDNFGWGAW
Ga0207657_1036652623300025919Corn RhizosphereMLEWKPRLFVLVVGIAVLAASLNGMFGLLAPGNFGWGAW
Ga0207664_1142500823300025929Agricultural SoilMLEWKPRLIVLVVGLAAVASSMGIVFWPINFGWGVW
Ga0208651_101426923300025998Rice Paddy SoilMLEWKPRLVVLVVGLVAFAASLGFSLGPGNFNWGAW
Ga0209056_1023951813300026538SoilMLEWKPRLIVLVVVVASLAAAYGWIFTAGNFGWDAW
Ga0209474_1059287013300026550SoilMLEWNPRLVALVVGVIAAAAALGFDFSPSNFGWGAW
Ga0179593_113160323300026555Vadose Zone SoilMLEWKPRLIVLVVGLAAMASSMGIVFWPINFGWGVW
Ga0208984_104232023300027546Forest SoilMLEWKPRLIVLVVGLAAVASSMGIEFWPVNFGWGLW
Ga0208989_1005322323300027738Forest SoilMLEWKPRLIVLVVGLAAVASSMGIEFWPINFGWGLW
Ga0209579_1015089323300027869Surface SoilMLEWKPRLIVLVLGIAVIAASLSGFFVMFDPSNFGWGAW
Ga0209590_1037162723300027882Vadose Zone SoilMLEWRPRLIVLVVGVAALASSIGFVFLPGNFGWGLW
Ga0209488_1052426833300027903Vadose Zone SoilGVLVSWRETMLEWKPRLIVLVVGLAAVASSMGIAFWPINFGWGVW
Ga0209526_1009379723300028047Forest SoilMLEWKPRLIVLVVGLAVMASSMGITFLPINFGWACW
Ga0307312_1009961423300028828SoilMLEWKPRLIVLVVGLAVVASSMGIVFWPINFGWGNW
Ga0307308_1055244623300028884SoilHVWRPSALEEKTMLEWKPRLIVLVAGLAALASSAGTLFGPGNFGWGLF
Ga0075382_1168683113300030917SoilWRPSALEGKSMLEWKPRLIVLVVGLIVLASTMGFVFEPINFGWGNW
Ga0102770_1123801313300030981SoilTMLEWKPRLIVLVAGLAALASSAGFVFGPGNFGWGLW
Ga0170834_10326343513300031057Forest SoilMLEWKPRLIVLVVGLIVLASTMGFVFEPINFGWGKW
Ga0170820_1087800623300031446Forest SoilMLEWKPRLIVLVVGLAAFAASSGFVFGPVNFGWGSW
Ga0170819_1791837423300031469Forest SoilSGVPSALEEKTMLEWKPRLIVLVVGLAAFAASSGFVFGPVNFGWGSW
Ga0307479_1070888823300031962Hardwood Forest SoilMLEWKPRLIVLVVGLAALASAAGFDFGPGNFGWGLW
Ga0308176_1165271723300031996SoilMLEWKPRLIVLVVVTAVIAASLNGMFLLFDPTNFG
Ga0307471_10030745623300032180Hardwood Forest SoilMLEWKPRLIVLVVGLIVLASSMGFVFEPINFGWGNW
Ga0307471_10288768713300032180Hardwood Forest SoilMLEWKPRLIVLVVGLAALASAAGTVFGPGNFGWGA
Ga0372943_0911650_93_2063300034268SoilMLEWNPRLVALVIGLATVISLFSGWIIFSVNFGWGAF
Ga0372946_0647686_63_1733300034384SoilMLEWKPRLIVLLVAVASLASSFGWLFSAGNFGWGAW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.