NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085980

Metagenome / Metatranscriptome Family F085980

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085980
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 48 residues
Representative Sequence MGSSTRIIKAALLAAAAALLAFAAFQLREKHQEAEAAVQNIHDQLDALDPA
Number of Associated Samples 100
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.18 %
% of genes near scaffold ends (potentially truncated) 98.20 %
% of genes from short scaffolds (< 2000 bps) 88.29 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.261 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.631 % of family members)
Environment Ontology (ENVO) Unclassified
(40.541 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.450 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 59.49%    β-sheet: 0.00%    Coil/Unstructured: 40.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF05239PRC 8.11
PF16912Glu_dehyd_C 2.70
PF00196GerE 2.70
PF06305LapA_dom 2.70
PF13191AAA_16 1.80
PF01042Ribonuc_L-PSP 1.80
PF00436SSB 1.80
PF11139SfLAP 1.80
PF10009DUF2252 1.80
PF00440TetR_N 0.90
PF09976TPR_21 0.90
PF08450SGL 0.90
PF00067p450 0.90
PF04525LOR 0.90
PF00498FHA 0.90
PF13424TPR_12 0.90
PF00999Na_H_Exchanger 0.90
PF12840HTH_20 0.90
PF00465Fe-ADH 0.90
PF08241Methyltransf_11 0.90
PF08240ADH_N 0.90
PF01047MarR 0.90
PF04185Phosphoesterase 0.90
PF11578DUF3237 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 2.70
COG2965Primosomal replication protein NReplication, recombination and repair [L] 1.80
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.80
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 1.80
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.90
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.90
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.90
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.90
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.90
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.90
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 0.90
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.90
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.90
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.90
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.90
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.90
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.90
COG2124Cytochrome P450Defense mechanisms [V] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.26 %
UnclassifiedrootN/A38.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B02IHH5IAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
2228664022|INPgaii200_c0780973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300000956|JGI10216J12902_102846082Not Available572Open in IMG/M
3300004092|Ga0062389_102390951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300004152|Ga0062386_101266693Not Available613Open in IMG/M
3300004152|Ga0062386_101875813Not Available500Open in IMG/M
3300004472|Ga0068974_1395974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii812Open in IMG/M
3300004478|Ga0068972_1350075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii899Open in IMG/M
3300004972|Ga0072325_1297372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii921Open in IMG/M
3300005169|Ga0066810_10104937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii630Open in IMG/M
3300005332|Ga0066388_101632269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium1137Open in IMG/M
3300005435|Ga0070714_101197701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae741Open in IMG/M
3300005437|Ga0070710_11255173Not Available549Open in IMG/M
3300005439|Ga0070711_101067675Not Available695Open in IMG/M
3300005764|Ga0066903_104788362Not Available720Open in IMG/M
3300005764|Ga0066903_105157771Not Available692Open in IMG/M
3300006028|Ga0070717_11287980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300006050|Ga0075028_100279925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii924Open in IMG/M
3300006059|Ga0075017_101555083Not Available522Open in IMG/M
3300006175|Ga0070712_101018809Not Available717Open in IMG/M
3300006176|Ga0070765_102293363Not Available503Open in IMG/M
3300006237|Ga0097621_101059502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300006579|Ga0074054_10647227Not Available539Open in IMG/M
3300006605|Ga0074057_10026524Not Available777Open in IMG/M
3300006854|Ga0075425_101657482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium720Open in IMG/M
3300006954|Ga0079219_11156943Not Available664Open in IMG/M
3300009147|Ga0114129_12179515All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009174|Ga0105241_11714718Not Available611Open in IMG/M
3300009177|Ga0105248_10200904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2246Open in IMG/M
3300010046|Ga0126384_11613319Not Available611Open in IMG/M
3300010048|Ga0126373_13177133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300010360|Ga0126372_11635982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia684Open in IMG/M
3300010361|Ga0126378_10023530All Organisms → cellular organisms → Bacteria5377Open in IMG/M
3300010366|Ga0126379_12401155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300010376|Ga0126381_103343182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300010396|Ga0134126_11207423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii840Open in IMG/M
3300011067|Ga0138594_1057865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii918Open in IMG/M
3300011080|Ga0138568_1153822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii930Open in IMG/M
3300011084|Ga0138562_1187637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii898Open in IMG/M
3300011110|Ga0138578_1233578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii891Open in IMG/M
3300012948|Ga0126375_10837687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300012961|Ga0164302_10804139All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012971|Ga0126369_13167223Not Available539Open in IMG/M
3300012986|Ga0164304_10644684Not Available797Open in IMG/M
3300016357|Ga0182032_11848081Not Available528Open in IMG/M
3300016371|Ga0182034_11655645Not Available562Open in IMG/M
3300016387|Ga0182040_10053385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2528Open in IMG/M
3300016387|Ga0182040_10427506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300017933|Ga0187801_10260314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300017935|Ga0187848_10275211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300017959|Ga0187779_10144181Not Available1464Open in IMG/M
3300017973|Ga0187780_10250164Not Available1241Open in IMG/M
3300017974|Ga0187777_10515460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia837Open in IMG/M
3300017999|Ga0187767_10115445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300018060|Ga0187765_10383138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300018085|Ga0187772_10381944Not Available978Open in IMG/M
3300021171|Ga0210405_10178531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300021560|Ga0126371_11467602Not Available811Open in IMG/M
3300025906|Ga0207699_11222540Not Available556Open in IMG/M
3300025938|Ga0207704_11825365Not Available523Open in IMG/M
3300026859|Ga0207859_1025301Not Available509Open in IMG/M
3300031546|Ga0318538_10190076Not Available1094Open in IMG/M
3300031549|Ga0318571_10090450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300031561|Ga0318528_10694720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300031564|Ga0318573_10006184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4803Open in IMG/M
3300031572|Ga0318515_10471862Not Available671Open in IMG/M
3300031679|Ga0318561_10822355All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300031681|Ga0318572_10250308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1042Open in IMG/M
3300031682|Ga0318560_10178596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300031719|Ga0306917_10140969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1779Open in IMG/M
3300031723|Ga0318493_10628644Not Available599Open in IMG/M
3300031724|Ga0318500_10275644All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031747|Ga0318502_10004889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5636Open in IMG/M
3300031764|Ga0318535_10001317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6809Open in IMG/M
3300031771|Ga0318546_10935013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300031779|Ga0318566_10452419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300031797|Ga0318550_10348635Not Available717Open in IMG/M
3300031805|Ga0318497_10877485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300031819|Ga0318568_10049296Not Available2423Open in IMG/M
3300031819|Ga0318568_10206700Not Available1211Open in IMG/M
3300031831|Ga0318564_10291579All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300031833|Ga0310917_10873956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300031845|Ga0318511_10175717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium945Open in IMG/M
3300031846|Ga0318512_10001556All Organisms → cellular organisms → Bacteria7166Open in IMG/M
3300031890|Ga0306925_10129809Not Available2703Open in IMG/M
3300031890|Ga0306925_11211506All Organisms → cellular organisms → Bacteria → Terrabacteria group756Open in IMG/M
3300031894|Ga0318522_10012341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2612Open in IMG/M
3300031912|Ga0306921_10077241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3830Open in IMG/M
3300031912|Ga0306921_11161720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera862Open in IMG/M
3300031941|Ga0310912_10063301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2639Open in IMG/M
3300031947|Ga0310909_11590730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300032001|Ga0306922_10718964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1050Open in IMG/M
3300032025|Ga0318507_10433544Not Available572Open in IMG/M
3300032054|Ga0318570_10241120Not Available819Open in IMG/M
3300032054|Ga0318570_10399563Not Available627Open in IMG/M
3300032054|Ga0318570_10541958All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300032055|Ga0318575_10248624All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300032063|Ga0318504_10390734Not Available663Open in IMG/M
3300032089|Ga0318525_10713308Not Available510Open in IMG/M
3300032160|Ga0311301_10761113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1342Open in IMG/M
3300032261|Ga0306920_100849357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300032261|Ga0306920_101875843All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300032515|Ga0348332_10762904Not Available769Open in IMG/M
3300032770|Ga0335085_10634917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1197Open in IMG/M
3300032770|Ga0335085_11084984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii859Open in IMG/M
3300032770|Ga0335085_11681661Not Available654Open in IMG/M
3300032897|Ga0335071_12015060All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300033158|Ga0335077_10275633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1852Open in IMG/M
3300033289|Ga0310914_10369093Not Available1298Open in IMG/M
3300033803|Ga0314862_0163663Not Available543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.41%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.60%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.70%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.90%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004472Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004972Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011067Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011110Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026859Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_030175002170459023Grass SoilMSASTRIIRAVLLAAAAAALAIAAYQLREKRQEAELTAEGIHDQLDALDPATRAAVV
INPgaii200_078097312228664022SoilMGSSTRIIKAALLAGAAALLAFAAFQLREKHQEAEAIVQNIHDQLDALDPATRAAV
JGI10216J12902_10284608223300000956SoilMSASTRIIRAVLLAAAAAALAIAAYQLREKHQEAELTVQDIHDQLDALDPATRA
Ga0062389_10239095123300004092Bog Forest SoilMSSSTRIIRAALLTAAAAVLAVAAVQLRSKHQTAELTVQNIHDQLDALDPVTRAAV
Ga0062386_10126669313300004152Bog Forest SoilMGSSTRIIQAALLAAAAAVLAVAAFQLRSKHQTAELAVQTIQDQLDALDPVTRA
Ga0062386_10187581313300004152Bog Forest SoilMGPSTQIIRAVLLAAAAAVLAAAAYQLREKHQRADLAVQNIHDQLDALDP
Ga0068974_139597423300004472Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQDQLDALDPATRAAV
Ga0068972_135007513300004478Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQDQ
Ga0072325_129737223300004972Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQDQLDALDPA
Ga0066810_1010493733300005169SoilMSQSTRILRAVLLAAAAVALAAAAYQLREKHEEAELTVQDIHDQLDALDPATRAAV
Ga0066388_10163226913300005332Tropical Forest SoilMGISTRMIRAVLLAAAAAALAVAAYQLREKHQEAELTVQNIHDQLDALDPAT
Ga0070714_10119770133300005435Agricultural SoilMSVPARIIRGALLAAAAAVLAAAACQLREKHQEAELTVQNIHDQLNASDPA
Ga0070710_1125517313300005437Corn, Switchgrass And Miscanthus RhizosphereMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEAEAVVDT
Ga0070711_10106767523300005439Corn, Switchgrass And Miscanthus RhizosphereMSVPARIIRGALLAAAAAVLAAAACQLREKHQEAELTVQNIHDQLNASDPATRTAVV
Ga0066695_1015766243300005553SoilMSASTRIIRAVLLAAAAAALAIAAYQLREKHQEAELTVQDIHDQLD
Ga0066903_10478836213300005764Tropical Forest SoilMGSSKRIIQAALLAAAAVALTAAAYLLRGKHQEAEAAVQTIQDQL
Ga0066903_10515777123300005764Tropical Forest SoilMAISNRIIRAVLLAAAAAALAVAAYQLREKHLEADEAVQAIHDQLDALDP
Ga0070717_1128798013300006028Corn, Switchgrass And Miscanthus RhizosphereMSSSTRIIRAALLAAAAALLAYAASQLREKHQEADLAVQNIHDQLDALDP
Ga0075028_10027992513300006050WatershedsMGSSTRIIRAALLAAAAAVLVAAAFLLSEKHQEAEAAVQSIQ
Ga0075017_10155508323300006059WatershedsMGSSTRIIRAALLAAAAAALAFAAYQLREKHQVAEAVVQN
Ga0070712_10101880913300006175Corn, Switchgrass And Miscanthus RhizosphereMGSSTRIIRAVLLAAAAAVLAAAAYQLREKHQEADLAVQNIHDQLDALDPA
Ga0070765_10229336313300006176SoilMDSPTRIIRAALLAAAAVLLAFAASQLRDKHREAEAVVQNIHDQIDALDPATRAA
Ga0097621_10105950223300006237Miscanthus RhizosphereMSSSTRIIRAALLAAAAALLAYAASQLREKHQEANLAVQNIHDQLDALDPATRA
Ga0074054_1064722713300006579SoilMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEAEALVQNIHDELDALDPATRA
Ga0074057_1002652413300006605SoilMSASTRIIRAVLLAAAAAALAIAAYQLREKHQEAELTVQDIHDQLDALDPATR
Ga0075425_10165748233300006854Populus RhizosphereMNSSARIIRVVLLAGAAVALAAAAYLLREKHQEAEGAVQSIEDQLDAL
Ga0079219_1115694313300006954Agricultural SoilMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEAEAVVDTIHDQLDALDPATRAAV
Ga0114129_1217951523300009147Populus RhizosphereMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEGEAVVQNIHDELD
Ga0105241_1171471823300009174Corn RhizosphereMSSSTRIIRAALLAAAAALLAYAASQLREKHQEADLAVQNIHDQLDALD
Ga0105248_1020090443300009177Switchgrass RhizosphereMSSSTRIIRAALLAAAAALFAYAASQLREKHQEANLAVQNIHDQLD
Ga0126384_1161331923300010046Tropical Forest SoilMAISKRIIRAVLLAAAAAALAVAAYQLREKHLEADEAVQAIHDQLDALDPVTRAAVIA
Ga0126373_1317713313300010048Tropical Forest SoilMAMSNRVIRALLLAAAAAALAVAAYQLREKHLEADEAVQAIHDRLDALDP
Ga0126372_1163598213300010360Tropical Forest SoilMVLRRIIRTALLTAVAIVLAAAAYQLREKRQEDNTAVQDIEDQLDALDPVQR
Ga0126378_1002353013300010361Tropical Forest SoilMTLSTRIIRALLLAAAAAALAVAAFQLREKHQEAE
Ga0126379_1240115523300010366Tropical Forest SoilMGPSTRIIRAVLLTAAGVALAAAAFLLREKHQEAEAAVQTIQDQLDALDPATRAAV
Ga0126381_10334318213300010376Tropical Forest SoilVLLAAAAAALAVAAYQLREKHQEAGLAVQNIHDQLDALDPATRAAVIA
Ga0134126_1120742323300010396Terrestrial SoilMGSPTRIIRAALLAAAAVFLAFAASQLRDKHREAEAFVQNIHD
Ga0138594_105786523300011067Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQDQLDALD
Ga0138568_115382223300011080Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQDQLDALDPATRA
Ga0138562_118763723300011084Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQNIQD
Ga0138578_123357823300011110Peatlands SoilMNSSTRTIRAVLLAGAAVALGAAAFLLREKHQEAEAAVQN
Ga0126375_1083768723300012948Tropical Forest SoilMKLPARIIRAVLLAAAAVALAAAAYQLREKHQEAEQAVQNIHDQLDALDPVTRAAVIA
Ga0164302_1080413913300012961SoilMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEAEAVVQNIHDELDALDPATR
Ga0126369_1316722313300012971Tropical Forest SoilMGSSTRVIRAALLAAAAMAFAAAAFLLREKHQEAEAAVQTIQDQLDALDPATRA
Ga0164304_1064468423300012986SoilMGSSTRIIRAALLAAAAAALVFAAFQLREKHQEAEAVVDTIHDQLDALDPA
Ga0182032_1184808113300016357SoilMGSSTRIIQAALLAGAAALLAFAAFQLREKHQEAEA
Ga0182034_1165564513300016371SoilMGSSKRIIQAVLLAAAATALAAAAYLLREKHQEAEVAVQTIQDQLDA
Ga0182040_1005338563300016387SoilMGSSTRIIQAALLAGAAALLAFAAFQLREKHQEAEAVVQDIHDQLDALDPAT
Ga0182040_1042750613300016387SoilMGMSKRGIRAVLLVAAAAALAAAAYQLREKHQEAELAVQNINDQLDALDPATRA
Ga0187801_1026031413300017933Freshwater SedimentMGSSTRIIKAALLAGAAALLAFAAFQLREKHQEAE
Ga0187848_1027521123300017935PeatlandMSSSTRIIRAALLTAAAAVLAVAAAQLRGKHQTAELAVQNIQDQLDAL
Ga0187779_1014418123300017959Tropical PeatlandMNSSTRVFRAVLLAGAAVALGAAAFLLREKHQEAEAAVQTIQDQLDALDPDLR
Ga0187780_1025016433300017973Tropical PeatlandMGSPTRIIRAALLAGAAALLAFAALQLREKHLEAEAVVQSIHDQLDALD
Ga0187777_1051546013300017974Tropical PeatlandMHSSTRIIRAVLLGAAAAILAAAAYQLREKHQEADLAVQNIHDQLDALDPAT
Ga0187767_1011544523300017999Tropical PeatlandMGSPTRIIRAALLAGAGALLAFAAFQLREKHQEAEAVVQDIHDQLDALDPATRAAV
Ga0187765_1038313833300018060Tropical PeatlandMGVPTRILRAVLLAAAAAVLAAAAYQLREKHQEADLTVQNIHDQLDALD
Ga0187772_1038194413300018085Tropical PeatlandMGSPTRIIRAALLAGAAALLAFAALQLREKHLEAEAVVQSIHDQLDAL
Ga0210405_1017853113300021171SoilMGSSTRIIRAALLAAAAVALAFAAAQLREKHHEAEAVVQNIHDQLDALDPAT
Ga0126371_1146760213300021560Tropical Forest SoilMGSSTRVIRAALLAAAAVALTAAAFLLREKHQEAEA
Ga0207699_1122254023300025906Corn, Switchgrass And Miscanthus RhizosphereMSVSTRIIRGALLAAAAAVLAAAAYQLREKHQEAELTVQNIHDQLDALDPATRAAVV
Ga0207704_1182536523300025938Miscanthus RhizosphereMSSSTRIIRAALLAAAAALLAYAASQLREKHQEANLAVQNIHDQLDAL
Ga0207859_102530113300026859Tropical Forest SoilMGSPTRIIRAALLAGAAALLAFAAFQLREKHQEAEAVVQNIHDQLDALDPAARAAVVAR
Ga0318538_1019007613300031546SoilMGSSTRIIKAALLAAAAALLAFAAFQLREKHQEAEAAVQNIHDQLDALDPA
Ga0318571_1009045013300031549SoilMGSSKRIIQAVLLAAAATALAAAAYLLREKHQEAEVAVQTIQD
Ga0318528_1069472013300031561SoilMGSSTRIIQAALLAGAAVLLAFAAFQLREKHQEAEAVVQNIHD
Ga0318573_1000618453300031564SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDAL
Ga0318515_1047186213300031572SoilMGSSTRMIKAALLAAAAALLAFAAFQLREKHQEAEAAVQNIHDQLDALD
Ga0318561_1082235513300031679SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQTIQDQLDALDPATRAA
Ga0318572_1025030833300031681SoilMGMSKRGIRAVLLVAAAAALAAAAYQLREKHQEADLAVQNIHDQLDALDPATRAA
Ga0318560_1017859633300031682SoilMHSSTRIIRAVLLAAAAAILAAAAYQLREKHQEADLAVQNIHDQLDALD
Ga0306917_1014096933300031719SoilMSSSTRIIRAALLAAAGVALAAAAYLLREKHQEAEAAVQDIQDQLDALDPAT
Ga0318493_1062864413300031723SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDALDPVTR
Ga0318500_1027564413300031724SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQTI
Ga0318502_1000488913300031747SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDALD
Ga0318535_1000131713300031764SoilMGSSTRIIQAALLAGAAVLLAFAAFQLREKHQEAEAVVQD
Ga0318546_1093501323300031771SoilMSQSTRILRAVLLAAAALALAAAAYQLREKHEEAELTVQDIHDQLDAL
Ga0318566_1045241913300031779SoilMHSSTRIIRAVLLAAAAAILAAAAYQLREKHQEADLAVQNIHDQLDA
Ga0318550_1034863513300031797SoilMGMSKRVIRAVLLVAAAAALAAAAYQLREKHQEAELAVRNIHDQLDALDPATRA
Ga0318497_1087748523300031805SoilMGMSKRVIRAVLLVAAAAALATAAYQLREKHQEAELAVRNIHDQLDALDPATRAAVIT
Ga0318568_1004929613300031819SoilMGSSTRIIQAALLAGAAALLAFAAFQLREKHQEAEAVVQDIHDQLDALD
Ga0318568_1020670023300031819SoilMGSSTRMIKAALLAAAAALLAFAAFQLREKHQEAEAAVQNIHDQLDALDPA
Ga0318564_1029157913300031831SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAE
Ga0310917_1087395643300031833SoilMGSSTRIIQAALLAGAAVLLAFAAFQLREKHQEAEAVVQNIHDQL
Ga0318511_1017571713300031845SoilMGSSKRIIQAALLAAAAVALTAAAYLLREKHQEAEAA
Ga0318512_1000155683300031846SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDALDPVTRAAVVT
Ga0306925_1012980913300031890SoilMGSSTRIIQAALLAGAAALLAFAAFQLREKHQEAEAVV
Ga0306925_1121150623300031890SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAV
Ga0318522_1001234113300031894SoilMSSSTRIIRAALLAAAGVALAAAAYLLREKHQEAEAAVQDIQDQLDALDPA
Ga0306921_1007724113300031912SoilMGMSKRGIRAVLLVAAAAALAAAAYQLREKHQEADLAVQNIHDQLDALDPATRAAVI
Ga0306921_1116172013300031912SoilMGSSTRIIKAVLLAGAAALLAFAAFQLREKHQEAEAVVQ
Ga0310912_1006330143300031941SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDALDPVTRA
Ga0310909_1159073013300031947SoilMGMSKRGVRAVLLVAAAAALAAAAYQLREKHQEAELAVQNIHDQLDALDPATRAA
Ga0306922_1071896413300032001SoilMSQSTRILRAVLLAAAALALAAAAYQLREKHEEAELTVQDIHDQLDALDPVT
Ga0318507_1043354413300032025SoilMGSSTRIIKAALLAAAAALLAFAAFQLREKHQEAEA
Ga0318570_1024112033300032054SoilMGSSTRIIQAALLAGAAALLAFAAFQLREKHQEAEAVVQDIHD
Ga0318570_1039956323300032054SoilMGSSKRIIQAALLAAAAVALTAAAYLLREKHQEAGAAVQTIQDQLDALDPAQRAGSR
Ga0318570_1054195813300032054SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQT
Ga0318575_1024862413300032055SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQTIQDQLDSLD
Ga0318504_1039073413300032063SoilMGSSTRMIKAALLAAAAALLAFAAFQLREKHQEAEAAVQNIHDQLDAL
Ga0318525_1071330813300032089SoilMSQSTRILRAVLLAAAALALAAAAYQLREKHEEAELTVQDIHDQLDALDPVTRAAVVT
Ga0311301_1076111333300032160Peatlands SoilMSQAPIIRVLLLAAAAAILVAAAEGLRHKHQQADLTVQNIHDQLDALDPATRS
Ga0306920_10084935733300032261SoilMSMSPRVIRALLLAAAAAALAFAASQFREKHQEAALTVQNIHDQLDA
Ga0306920_10187584313300032261SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQTIQDQLDSLDPAT
Ga0348332_1076290413300032515Plant LitterMGSSTRIIRAALLAAAAAALAFAAYQLREKHQEAEAVVQ
Ga0335085_1063491713300032770SoilMGSSTRIIRGALLAAAAAALVAAAYLLRENHQEAEAAV
Ga0335085_1108498423300032770SoilMGSPTRIIRVALLAAAAALLAFAASQLREKHREAEAAVQNIHDQLDAL
Ga0335085_1168166113300032770SoilMGSSKRIIQAALLAAAAVALTAAAYLLREKHQEAEAAVQTIQDQLDALDPAQ
Ga0335071_1201506013300032897SoilMGSSTQIMRAALLAAAAVALVAAAYLLREKHQEAEAAVQTIQD
Ga0335077_1027563343300033158SoilMSSSSTRIIRAALLAAAAVVLAIAAAQLREKHHEAEDAVQSIHDQLDALDPAT
Ga0310914_1036909313300033289SoilMGSSTRIIQAALLAGAAVLLAFAAFQLREKHQEAEAVVQDIH
Ga0314862_0163663_436_5433300033803PeatlandMNSSTRVFRAVLLAGAAVALGAAAFLLREKHQEAEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.