Basic Information | |
---|---|
Family ID | F085975 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 46 residues |
Representative Sequence | LTKTKRVNVQSSKEIPATLDGEKVNLGRSAEIDFVSRALTVLVPAK |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.90 % |
% of genes near scaffold ends (potentially truncated) | 95.50 % |
% of genes from short scaffolds (< 2000 bps) | 89.19 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.297 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.423 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.847 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.739 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.73% Coil/Unstructured: 70.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF06745 | ATPase | 35.14 |
PF03631 | Virul_fac_BrkB | 17.12 |
PF13439 | Glyco_transf_4 | 1.80 |
PF09061 | Stirrup | 1.80 |
PF01594 | AI-2E_transport | 1.80 |
PF13520 | AA_permease_2 | 1.80 |
PF00781 | DAGK_cat | 1.80 |
PF01145 | Band_7 | 0.90 |
PF00011 | HSP20 | 0.90 |
PF04972 | BON | 0.90 |
PF01936 | NYN | 0.90 |
PF00144 | Beta-lactamase | 0.90 |
PF13460 | NAD_binding_10 | 0.90 |
PF05957 | DUF883 | 0.90 |
PF02518 | HATPase_c | 0.90 |
PF07730 | HisKA_3 | 0.90 |
PF04977 | DivIC | 0.90 |
PF02653 | BPD_transp_2 | 0.90 |
PF13419 | HAD_2 | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 17.12 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 3.60 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.80 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.90 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.90 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.90 |
COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.90 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.90 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.90 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.90 |
COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.90 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.90 |
COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.30 % |
Unclassified | root | N/A | 2.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17296352 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
2088090015|GPICI_9134685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1076 | Open in IMG/M |
2170459003|FZN2CUW02I65Z3 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
2170459009|GA8DASG02G8I0Q | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1043621 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300000891|JGI10214J12806_10094309 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 944 | Open in IMG/M |
3300000956|JGI10216J12902_101728776 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 958 | Open in IMG/M |
3300000956|JGI10216J12902_102017862 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300001139|JGI10220J13317_10351220 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300002090|JGI24806J26614_1020124 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300002128|JGI24036J26619_10018249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1292 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10022126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1022 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10107852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
3300004156|Ga0062589_100985449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 786 | Open in IMG/M |
3300004463|Ga0063356_100131853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2802 | Open in IMG/M |
3300004463|Ga0063356_100781237 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300004479|Ga0062595_100293038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300005093|Ga0062594_102725805 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005178|Ga0066688_10136401 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300005179|Ga0066684_10514479 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005184|Ga0066671_10611543 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300005187|Ga0066675_10325661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1118 | Open in IMG/M |
3300005289|Ga0065704_10393271 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 760 | Open in IMG/M |
3300005294|Ga0065705_10012713 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
3300005294|Ga0065705_10023520 | All Organisms → cellular organisms → Bacteria | 3288 | Open in IMG/M |
3300005295|Ga0065707_10015327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1862 | Open in IMG/M |
3300005327|Ga0070658_11007939 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300005329|Ga0070683_102337424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
3300005339|Ga0070660_101767110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
3300005354|Ga0070675_100881780 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005451|Ga0066681_10318261 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005454|Ga0066687_10047617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1981 | Open in IMG/M |
3300005546|Ga0070696_100049340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2924 | Open in IMG/M |
3300006046|Ga0066652_101484970 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300006175|Ga0070712_101569853 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300007258|Ga0099793_10562300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
3300009137|Ga0066709_101393414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1020 | Open in IMG/M |
3300010043|Ga0126380_11805637 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010323|Ga0134086_10204903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 738 | Open in IMG/M |
3300010326|Ga0134065_10117256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 901 | Open in IMG/M |
3300010375|Ga0105239_11425281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 800 | Open in IMG/M |
3300010396|Ga0134126_10573343 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300012198|Ga0137364_10075029 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
3300012198|Ga0137364_10188520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1507 | Open in IMG/M |
3300012198|Ga0137364_11222181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
3300012208|Ga0137376_11737434 | Not Available | 515 | Open in IMG/M |
3300012211|Ga0137377_10705769 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 943 | Open in IMG/M |
3300012285|Ga0137370_10561683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
3300012356|Ga0137371_11175374 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300012683|Ga0137398_10719863 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 694 | Open in IMG/M |
3300012685|Ga0137397_10560077 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300012882|Ga0157304_1012966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 964 | Open in IMG/M |
3300012882|Ga0157304_1079589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
3300012924|Ga0137413_10461398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 927 | Open in IMG/M |
3300012927|Ga0137416_10393636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1172 | Open in IMG/M |
3300012930|Ga0137407_11231979 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300012957|Ga0164303_10163381 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1193 | Open in IMG/M |
3300012960|Ga0164301_11091756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 634 | Open in IMG/M |
3300013306|Ga0163162_12897269 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300014157|Ga0134078_10380705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter | 628 | Open in IMG/M |
3300014968|Ga0157379_10661142 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300015200|Ga0173480_10689668 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 639 | Open in IMG/M |
3300015241|Ga0137418_10398267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1124 | Open in IMG/M |
3300015242|Ga0137412_10345751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1159 | Open in IMG/M |
3300015264|Ga0137403_11469067 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
3300015373|Ga0132257_103095406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
3300015374|Ga0132255_106281745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
3300018028|Ga0184608_10043392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1745 | Open in IMG/M |
3300018028|Ga0184608_10078875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1347 | Open in IMG/M |
3300018072|Ga0184635_10079553 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300018075|Ga0184632_10334832 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300018076|Ga0184609_10169498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1010 | Open in IMG/M |
3300018433|Ga0066667_11438326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
3300019881|Ga0193707_1178265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300019882|Ga0193713_1180424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
3300019885|Ga0193747_1092120 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300019885|Ga0193747_1109377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
3300019885|Ga0193747_1117306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
3300019886|Ga0193727_1103529 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300019886|Ga0193727_1117304 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300020001|Ga0193731_1043024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1192 | Open in IMG/M |
3300021078|Ga0210381_10179735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 730 | Open in IMG/M |
3300021086|Ga0179596_10563251 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
3300021344|Ga0193719_10257172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 737 | Open in IMG/M |
3300021363|Ga0193699_10176874 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300022892|Ga0247753_1027993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
3300024288|Ga0179589_10589546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
3300025290|Ga0207673_1010747 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300025893|Ga0207682_10588306 | Not Available | 525 | Open in IMG/M |
3300025918|Ga0207662_11288984 | Not Available | 519 | Open in IMG/M |
3300025933|Ga0207706_10044174 | All Organisms → cellular organisms → Bacteria | 3950 | Open in IMG/M |
3300025961|Ga0207712_10778995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 840 | Open in IMG/M |
3300026552|Ga0209577_10003716 | All Organisms → cellular organisms → Bacteria | 14368 | Open in IMG/M |
3300027552|Ga0209982_1062845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
3300028536|Ga0137415_11394804 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
3300028784|Ga0307282_10542236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300028811|Ga0307292_10199835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 821 | Open in IMG/M |
3300028828|Ga0307312_10044691 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
3300028884|Ga0307308_10030130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 2522 | Open in IMG/M |
3300028885|Ga0307304_10163844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 934 | Open in IMG/M |
3300031231|Ga0170824_102875113 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031474|Ga0170818_106566409 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300031474|Ga0170818_110965058 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300031547|Ga0310887_10779420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
3300031562|Ga0310886_10020815 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46 | 2623 | Open in IMG/M |
3300031716|Ga0310813_10811064 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300032421|Ga0310812_10511596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
3300033412|Ga0310810_10177431 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2439 | Open in IMG/M |
3300033412|Ga0310810_10560015 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1113 | Open in IMG/M |
3300033412|Ga0310810_11303981 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300033475|Ga0310811_11388498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02556520 | 2088090014 | Soil | NILLTKTKRVRVQSSKDIPATLDGEIVNLGTSAEINFISRALTVLVPAR |
GPICI_00447290 | 2088090015 | Soil | XXXRNIRLTKTKRVDVQSSKDIPATLDGERVNLGRSAEIDFVSRAVTVIVPA |
E4A_12178520 | 2170459003 | Grass Soil | QSSKDIPATLDGEKVNLGRSAEIDFVPHALTVLVPAK |
F47_04128320 | 2170459009 | Grass Soil | VQSSKDIPGVLDGEKVNLGRSAEINFVSKAVTVLVPASS |
KanNP_Total_noBrdU_T14TCDRAFT_10436212 | 3300000596 | Soil | NILLTKTRRVGVQSSKDIPAILDGESVNLGKSAEIDFISNAVKVLVPAK* |
JGI10214J12806_100943091 | 3300000891 | Soil | KRVDVQSSKDIPATLDGERVNLGRSAEIDFVSRAVTVIVPAK* |
JGI10216J12902_1017287762 | 3300000956 | Soil | MSEYSSHETDQVRVQSSKDIPGILDGEKVNLGRSAEVNFVSKAVTVFVPTSG* |
JGI10216J12902_1020178623 | 3300000956 | Soil | KDIPAMLDGERVNLGRSAEIDFVSKAVSVLVPAK* |
JGI10220J13317_103512202 | 3300001139 | Soil | KTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS* |
JGI24806J26614_10201241 | 3300002090 | Soil | LTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFMSKAVTVLVPASS* |
JGI24036J26619_100182492 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVQSSKDIPGILDGEKVNLGGSAEINFVSKTVTVLVPTSG* |
JGIcombinedJ43975_100221263 | 3300002899 | Soil | VLTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFMSKAVTVLVPASS* |
JGIcombinedJ43975_101078521 | 3300002899 | Soil | MARYRNIVLTKTNKVRVQSSKDIPGILDGEKVNLGKSAEISFVSKAVTVLVPASS* |
Ga0062589_1009854491 | 3300004156 | Soil | RTPHQAKRVSVQSRKNIPATLDGKNVSPGASVEIDFVSEAVKVLVPAK* |
Ga0063356_1001318531 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WRDNRNIVLTKTNQVRVQSSEDIPGILDGEKVNLGRSADINFVSKAVTVLAPCQ* |
Ga0063356_1007812371 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LTKTKRLAVQSNNEIPATLDGESVNLGTRAEIDFVSRALTVLVPAK* |
Ga0062595_1002930382 | 3300004479 | Soil | KRVTVQSRKDIPAMLDGENVSLGTSAEIDFVSRAVNILVPAN* |
Ga0062594_1027258051 | 3300005093 | Soil | WRDDKNILLTKTKRVDVQSSKDIPATLDGERVNLGMSAEIDFVSRALTVLVPSK* |
Ga0066688_101364013 | 3300005178 | Soil | MARRQNILLTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFVSRALTVLVP |
Ga0066684_105144791 | 3300005179 | Soil | DKDILLTKTKRVDIRSGSDMPAILDGERVNLGSTAEINFVSRAVDVIVPGR* |
Ga0066671_106115431 | 3300005184 | Soil | RQNILLTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFVSRALTVLVPAR* |
Ga0066675_103256611 | 3300005187 | Soil | NILLTKTKRVNVQSSNDIPATLDGERVNLGMSAEIDFVPNALTVLVPAK* |
Ga0065704_103932712 | 3300005289 | Switchgrass Rhizosphere | TKTKRVDVQSSKDIPATLDGERVNLGRSVEIDFVSRAVTVIVPAK* |
Ga0065705_100127134 | 3300005294 | Switchgrass Rhizosphere | WRDNRNIVLTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS* |
Ga0065705_100235206 | 3300005294 | Switchgrass Rhizosphere | TNQVRVQSSKDIPGILDGEKVNLGGSAEINFVSKTVTVLVPTSG* |
Ga0065707_100153273 | 3300005295 | Switchgrass Rhizosphere | DNRNIVLTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS* |
Ga0070658_110079392 | 3300005327 | Corn Rhizosphere | KTKRVSVQSSKDIPATLDGEIVSLGTSAEINFVSRALTVLVPAK* |
Ga0070683_1023374242 | 3300005329 | Corn Rhizosphere | ILLTKTKRVNVRSSKEIPATLDGEKVNLGRSAEIDFVSRALTVLVPAR* |
Ga0070660_1017671102 | 3300005339 | Corn Rhizosphere | RVNVQSIKEIPATLDGEKVNLGRSAEIDFVSRALTVLVPAR* |
Ga0070675_1008817801 | 3300005354 | Miscanthus Rhizosphere | LTKAKRVDVQSSTDIHATLDGERVNLGRSAQIDFVSGALTVLVPAK* |
Ga0066681_103182611 | 3300005451 | Soil | RTKRVSVESSKDIPAILDGERINLGRSARIEFVSKAVKVIVAGNN* |
Ga0066687_100476171 | 3300005454 | Soil | MARRQNILLTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFV |
Ga0070696_1000493401 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TKTKRVDIRSGSDMPAILDGERVDLGCSTEINFVSKAVTVLVPASG* |
Ga0066652_1014849702 | 3300006046 | Soil | WRDDRNILLTKTKRVDVQSSKDIPATLDGEKVNLGRSAEIDFVSRALTVLVPAK* |
Ga0070712_1015698532 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QSSKDIPAMLDGEIVNLGRSAEINFVSRALTVLVPAK* |
Ga0099793_105623001 | 3300007258 | Vadose Zone Soil | KVHLAKTERSAVQSSKDIPATLDGERVTLGRSAEIDFVSGALTVLVPAR* |
Ga0066709_1013934141 | 3300009137 | Grasslands Soil | RRQNILLTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFVSRALTVLVPAR* |
Ga0126380_118056371 | 3300010043 | Tropical Forest Soil | RIVVRSNKEIPSTLDGESVNLGVQAQFDFVSRAVTVLVPAK* |
Ga0134086_102049031 | 3300010323 | Grasslands Soil | VTETKRLAVQSSKEIPATLNRENVNLGTRAELDFVSRAITVL |
Ga0134065_101172562 | 3300010326 | Grasslands Soil | LTKTKRVNVQSSDVITATLDGERVNLGRSAEIDFVSRALTVLVPAK* |
Ga0105239_114252813 | 3300010375 | Corn Rhizosphere | RVNVQSSKEIPATLDGEKVNLGRSAEIDFVSKALTVLAPAR* |
Ga0134126_105733431 | 3300010396 | Terrestrial Soil | IRSGSDMPAILDGERVDLGCSTEINFVSKAVTVLVPASG* |
Ga0137364_100750291 | 3300012198 | Vadose Zone Soil | SKEIPATLDGEKVNLGRSAEIDFVSRALTVLVPRK* |
Ga0137364_101885201 | 3300012198 | Vadose Zone Soil | KEIPATLDGEKVNLGRSAEIDFVSRALTVLVPGR* |
Ga0137364_112221811 | 3300012198 | Vadose Zone Soil | TKRVGVQSSKDIPATLDGENVNLGTSAEIDFVSRALTVIVPAK* |
Ga0137376_117374341 | 3300012208 | Vadose Zone Soil | RNVLLTKAKRVSVQSRKDIPATLDGENVSLGASAEIDFVSRAVNVLVPVK* |
Ga0137377_107057691 | 3300012211 | Vadose Zone Soil | NILLTKTKRIGVQSSKDIPAILDGERVNLGSSAEIDFVSRALTVIVPAK* |
Ga0137370_105616831 | 3300012285 | Vadose Zone Soil | RVGVQSSKDIPATLDGENVSLGTSAEIDFVARALTVIVPAK* |
Ga0137371_111753742 | 3300012356 | Vadose Zone Soil | RDDRKILLTKTKRLAVQSSKEIPATLDGESVKLGTRAQIDFVSRGITVLVPGK* |
Ga0137398_107198632 | 3300012683 | Vadose Zone Soil | DRNILLTKTKRVDVQSSKDIPATLDGERVNLGRSAEIDFVSRALTVLVPAK* |
Ga0137397_105600772 | 3300012685 | Vadose Zone Soil | DDRNILLTKTKRVAMQSGKDIPAILDGERVNLGRSAEIAFVSRAVTVIVPAK* |
Ga0157304_10129662 | 3300012882 | Soil | RDDRNILLTKTKRVNVQSTKEIPATLDGEKINLDRSAEIDFVSRALTVLVPAR* |
Ga0157304_10795893 | 3300012882 | Soil | TKTNQVRVHSSKDIRGILDGEKVNLGTSAEINFVSKAVTVLVPTSG* |
Ga0137413_104613981 | 3300012924 | Vadose Zone Soil | NILLTKTKRVDVQSSKDIPATLDGERVDLGRSAEIDFVSRALTVLVPAK* |
Ga0137416_103936362 | 3300012927 | Vadose Zone Soil | DRNILLTKTKRVDVQSSKDIPATLDGETVNLGRSAEIDFVSSAVNVIAPAK* |
Ga0137407_112319792 | 3300012930 | Vadose Zone Soil | PAMLDGERVNLGRSAEIDFVSRAVNLIVPSRCAETR* |
Ga0164303_101633811 | 3300012957 | Soil | LLTKTKRIDVQSSEDIPAMLDGERVNLGRSAEIDFVSSALTVLVPAK* |
Ga0164301_110917562 | 3300012960 | Soil | VLLTKTKRIDVQSSEDIPAMLDGERVNLGRSAEIDFVSRALTVLVPAS* |
Ga0163162_128972692 | 3300013306 | Switchgrass Rhizosphere | NQVRVQSSKDIPAILDGEKVNLGRRAEINFVSKAVTVLVPASS* |
Ga0134078_103807053 | 3300014157 | Grasslands Soil | VLLTKAKRVSVQSRKNIPATLDGENVTLSASAEIDFVSQAVKILVPAK* |
Ga0157379_106611423 | 3300014968 | Switchgrass Rhizosphere | LLTKTKRVDIRSGSDMPAILDGERVDLGCSTEINFVSKAVTVLVPASG* |
Ga0173480_106896682 | 3300015200 | Soil | VLTKTKQVRVHSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPTSG* |
Ga0137418_103982672 | 3300015241 | Vadose Zone Soil | KDIPATLDGESINLGTSAEIDFVSRALTVIVSAK* |
Ga0137412_103457511 | 3300015242 | Vadose Zone Soil | KDIPATLDGERVNLGRSAEIDFVSRALTVLVPAK* |
Ga0137403_114690672 | 3300015264 | Vadose Zone Soil | ILLTKTKRVNVQSSNDIPATLDGEKVNLGRSAEIDFVPRALTVLVPAK* |
Ga0132257_1030954061 | 3300015373 | Arabidopsis Rhizosphere | DKNILLTKTKRVDVQSSKEIPATLDGEKVNLGRSAEIVFVSKALTVLVPAS* |
Ga0132255_1062817452 | 3300015374 | Arabidopsis Rhizosphere | KEIPATLDGEKVNLGRSAEIVFVSKALTVVVPAS* |
Ga0184608_100433921 | 3300018028 | Groundwater Sediment | TKTKRVGVQSSKNIPAILDGEIVNLGRSAQIDFVSRAVHVLVPAK |
Ga0184608_100788752 | 3300018028 | Groundwater Sediment | LLTKTKRVALQSSKDIPAILDGERVNLGRSAEINFVSRAVNVLVPAK |
Ga0184635_100795531 | 3300018072 | Groundwater Sediment | KWRDDRNILLTKTKRVDVQSSKDIPATLDGEIVNLGTSAEINFVSRALTVLVPAK |
Ga0184632_103348321 | 3300018075 | Groundwater Sediment | HSSKDIPATLDGERVNLGRSAEIDFVSRALTVLVPAK |
Ga0184609_101694982 | 3300018076 | Groundwater Sediment | VQSSKDIPAILDGEGVNFGRSAEIDFGSRAVDVIVPAKQVF |
Ga0066667_114383261 | 3300018433 | Grasslands Soil | LTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFVSRALTVLVPAR |
Ga0193707_11782652 | 3300019881 | Soil | IPVCAVLDGDKINLGRSAEINFVPKAVTVLVPACR |
Ga0193713_11804242 | 3300019882 | Soil | TKTKRVNVQSSKEIPATLDGEKVNLGRSAEIDFVSKALTVLVPAS |
Ga0193747_10921201 | 3300019885 | Soil | RDDRHVHLTKTKRLAVQSGKEIPATLDGESVNLGMRAEFDFVSRAVTVLVPAK |
Ga0193747_11093771 | 3300019885 | Soil | GKWRNDRNILLTKTKRVDVQSSKDIPATLDGEKVNLGRSVEIDFVSRALTVLVPAK |
Ga0193747_11173062 | 3300019885 | Soil | SKDIPATLDGEKVNLGRSAEIDFVSHALTVLVPAK |
Ga0193727_11035291 | 3300019886 | Soil | QSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS |
Ga0193727_11173041 | 3300019886 | Soil | TNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS |
Ga0193731_10430241 | 3300020001 | Soil | GRWRDDRNILLTKTKRVGVQSSKDIPATLDGESVSLGKSAEIDFVSRALTVIVPAK |
Ga0210381_101797351 | 3300021078 | Groundwater Sediment | KTKRVNVQSSKDIPATLDGEKVNLGRSAEIDFVSHALTVLVPAK |
Ga0179596_105632512 | 3300021086 | Vadose Zone Soil | HNENVFLTRTKRVGVQSSKDIPAILDGERVNLGRSAQIDFVSKAIKVIVAGNN |
Ga0193719_102571721 | 3300021344 | Soil | LLTKTKRVGVQSSKDIPATLDGESVSLGKSAEIDFVSRALTVIVPAK |
Ga0193699_101768742 | 3300021363 | Soil | KIHLTKTKRLAVQSSKGIPATLDGESVNLGMRAEFDFVSRAVTVLVPAK |
Ga0247753_10279931 | 3300022892 | Soil | NILLTKTKRVNVQSTKEIPATLDGEKINLGRSAEIDFVSRALTVLVPAR |
Ga0179589_105895461 | 3300024288 | Vadose Zone Soil | DRKVHLAKTEGSAVQSSKDIPAMLDGEKVNLGRNAEIDFVSKALTVLVPSK |
Ga0207673_10107471 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLAKTKRVSVQSSKDIPATLDGEIVSLGTSAEINFVSRALTVLVPAK |
Ga0207682_105883062 | 3300025893 | Miscanthus Rhizosphere | NKDILLTKTKRVDIRSGSDMPAILDGERVDLGCSTEINFVSKAVTVLVPASG |
Ga0207662_112889841 | 3300025918 | Switchgrass Rhizosphere | KDILLTKTKRVDIRSGSDMPAILDGERVDLGCSTEINFVSKAVTVLVPASG |
Ga0207706_100441741 | 3300025933 | Corn Rhizosphere | EDTSHQTNQVRVQSSKDIPGILDGEKVNLGGSAEINFVSKTVTVLVPTSG |
Ga0207712_107789951 | 3300025961 | Switchgrass Rhizosphere | SKDIPAILDGERVNLGRSAEIDFVSRAVNVIVAAK |
Ga0209577_1000371611 | 3300026552 | Soil | MARRQNILLTKTKRVNVQSSKEIPAALDGEKVNLGRSVEIDFVSRALTVLVPAR |
Ga0209982_10628452 | 3300027552 | Arabidopsis Thaliana Rhizosphere | VDVQSKTDIPATLDGERVNLGRSAEIDFVSRAVTVIVPAK |
Ga0137415_113948042 | 3300028536 | Vadose Zone Soil | RVNVQSSKDIPATLDGETVNLGRSAEIDFVSSAVNVIAPAK |
Ga0307282_105422362 | 3300028784 | Soil | KRVRVQSTKDIPATLDGESVSLGTSVEIDFVSRALAVLVPAK |
Ga0307292_101998351 | 3300028811 | Soil | RVNVQSTKEIPATLDGEKVNLGRSAEIDFVSKALTVLVPAT |
Ga0307312_100446913 | 3300028828 | Soil | VGVQSGKDIPATLDGESINLGTSAEIDFVSRALTVIVPAK |
Ga0307308_100301301 | 3300028884 | Soil | VQSGKDIPATLDGESINLGTSAEIDFVSRALTVIVPAK |
Ga0307304_101638442 | 3300028885 | Soil | KWRNNRNIVLTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS |
Ga0170824_1028751131 | 3300031231 | Forest Soil | VQSSKDIPATLDGEKVNLGMSAEIDFVSRALTVLVPSK |
Ga0170818_1065664091 | 3300031474 | Forest Soil | DVQSSKDIPATLDGEVVNLGTSAEINFVSRALTVLVPAK |
Ga0170818_1109650582 | 3300031474 | Forest Soil | VQSNKDIPATLDGEVVNLGTSAEINFVSRALTVLVPAK |
Ga0310887_107794202 | 3300031547 | Soil | RNDIPAILDGEKINLGGSAEITFVPKAVTVLVPACR |
Ga0310886_100208151 | 3300031562 | Soil | KWRDDRNILLTKAKRVDVQSSTDIPATLDGERVNLGRSAQIDFVSGALTVLVPAK |
Ga0310813_108110641 | 3300031716 | Soil | KNILLTKTKRVSVQSSKDIPATLDGEIVNLGTSAEINFVSRALTVLVPAK |
Ga0310812_105115961 | 3300032421 | Soil | SSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS |
Ga0310810_101774312 | 3300033412 | Soil | LTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPAGD |
Ga0310810_105600151 | 3300033412 | Soil | KTKRVDVQSSKEIPATLDGEKVNLGRSAEIVFVSKALTVLVPAS |
Ga0310810_113039811 | 3300033412 | Soil | LTKTNQVRVQSSKDIPGILDGEKVNLGRSAEINFVSKAVTVLVPASS |
Ga0310811_113884982 | 3300033475 | Soil | LTKTKRVNVQSSKEIPATLDGEKVNLGRSAEIDFVSRALTVLVPAK |
⦗Top⦘ |