NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085934

Metagenome / Metatranscriptome Family F085934

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085934
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 40 residues
Representative Sequence EEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Number of Associated Samples 98
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.50 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.297 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.324 % of family members)
Environment Ontology (ENVO) Unclassified
(30.631 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.955 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.92%    β-sheet: 0.00%    Coil/Unstructured: 63.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF03544TonB_C 1.80
PF01553Acyltransferase 1.80
PF05163DinB 0.90
PF12867DinB_2 0.90
PF01370Epimerase 0.90
PF00679EFG_C 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.80
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.30 %
UnclassifiedrootN/A2.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102GR43CNot Available507Open in IMG/M
3300002245|JGIcombinedJ26739_100959497All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300002906|JGI25614J43888_10205762All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300002917|JGI25616J43925_10293206All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300005467|Ga0070706_100824414All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300005536|Ga0070697_102127456All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300005537|Ga0070730_10732058All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005602|Ga0070762_10253247All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300005921|Ga0070766_10203950All Organisms → cellular organisms → Bacteria → Acidobacteria1237Open in IMG/M
3300006052|Ga0075029_100928418All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006059|Ga0075017_100965415All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300006176|Ga0070765_100849637All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300006871|Ga0075434_100909563All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300006903|Ga0075426_10624363All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300007255|Ga0099791_10091979All Organisms → cellular organisms → Bacteria → Acidobacteria1390Open in IMG/M
3300007258|Ga0099793_10476414All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300007265|Ga0099794_10145885All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300009012|Ga0066710_104886045All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009792|Ga0126374_11737360Not Available520Open in IMG/M
3300010048|Ga0126373_12683125All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300010303|Ga0134082_10446678All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300010329|Ga0134111_10322578All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300010339|Ga0074046_10204476All Organisms → cellular organisms → Bacteria → Acidobacteria1240Open in IMG/M
3300010361|Ga0126378_10975424All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300010361|Ga0126378_13263444All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300010362|Ga0126377_10415168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1360Open in IMG/M
3300010376|Ga0126381_104616856All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300010379|Ga0136449_102499270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300010877|Ga0126356_11107291All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300011270|Ga0137391_10984969All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300011271|Ga0137393_10061539All Organisms → cellular organisms → Bacteria → Acidobacteria2965Open in IMG/M
3300011271|Ga0137393_10105267All Organisms → cellular organisms → Bacteria → Acidobacteria2309Open in IMG/M
3300011271|Ga0137393_11151521All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300012096|Ga0137389_10967016All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300012189|Ga0137388_10315909All Organisms → cellular organisms → Bacteria → Acidobacteria1435Open in IMG/M
3300012189|Ga0137388_10548371All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300012189|Ga0137388_10706671All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300012205|Ga0137362_10464314All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300012361|Ga0137360_10195814All Organisms → cellular organisms → Bacteria → Acidobacteria1633Open in IMG/M
3300012363|Ga0137390_10803390All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300012918|Ga0137396_10452528All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300012918|Ga0137396_11044907All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300014166|Ga0134079_10435130All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300015053|Ga0137405_1049353All Organisms → cellular organisms → Bacteria → Acidobacteria1201Open in IMG/M
3300015054|Ga0137420_1002248All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300015241|Ga0137418_10599919All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300015264|Ga0137403_10947962All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300016294|Ga0182041_10586471All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300016341|Ga0182035_11198328Not Available678Open in IMG/M
3300016422|Ga0182039_10877887All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300016422|Ga0182039_11111789All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300017822|Ga0187802_10041891All Organisms → cellular organisms → Bacteria → Acidobacteria1658Open in IMG/M
3300017961|Ga0187778_11013726All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300018012|Ga0187810_10202611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300018019|Ga0187874_10474505All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300019284|Ga0187797_1469476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300021046|Ga0215015_10451641All Organisms → cellular organisms → Bacteria → Acidobacteria1233Open in IMG/M
3300021168|Ga0210406_10729093All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300021168|Ga0210406_11290221All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021401|Ga0210393_11299364All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300021406|Ga0210386_11032609All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300021406|Ga0210386_11733370All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300021407|Ga0210383_11376846All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300021432|Ga0210384_11584489All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300021433|Ga0210391_10332793All Organisms → cellular organisms → Bacteria → Acidobacteria1191Open in IMG/M
3300021433|Ga0210391_10972316All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300021475|Ga0210392_11052612All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300021478|Ga0210402_10935828All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300021478|Ga0210402_11093581All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300021559|Ga0210409_11169767All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300021560|Ga0126371_10700372All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300022533|Ga0242662_10356869All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300022726|Ga0242654_10260581All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300024331|Ga0247668_1083174All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300025922|Ga0207646_10505824All Organisms → cellular organisms → Bacteria → Acidobacteria1088Open in IMG/M
3300026515|Ga0257158_1050194All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300026552|Ga0209577_10870852All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300026760|Ga0207630_104682All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300026819|Ga0207765_118012All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300027042|Ga0207766_1013468All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300027853|Ga0209274_10557996All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300027855|Ga0209693_10433150All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300027898|Ga0209067_10008678All Organisms → cellular organisms → Bacteria → Acidobacteria5451Open in IMG/M
3300027903|Ga0209488_10401567All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300029636|Ga0222749_10035803All Organisms → cellular organisms → Bacteria → Acidobacteria2133Open in IMG/M
3300030862|Ga0265753_1065845All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031543|Ga0318516_10850717All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031572|Ga0318515_10033975All Organisms → cellular organisms → Bacteria → Acidobacteria2506Open in IMG/M
3300031590|Ga0307483_1011956All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300031681|Ga0318572_10851106All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031715|Ga0307476_11080239All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031720|Ga0307469_11098163All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300031744|Ga0306918_10402551All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300031754|Ga0307475_11251238All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300031764|Ga0318535_10089466All Organisms → cellular organisms → Bacteria → Acidobacteria1339Open in IMG/M
3300031764|Ga0318535_10436026All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300031768|Ga0318509_10221830All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300031820|Ga0307473_10903355All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300031894|Ga0318522_10170676All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300031910|Ga0306923_11686736All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031912|Ga0306921_11986808All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300031912|Ga0306921_11999750All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300031954|Ga0306926_10749601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1181Open in IMG/M
3300032001|Ga0306922_10717096All Organisms → cellular organisms → Bacteria → Acidobacteria1051Open in IMG/M
3300032035|Ga0310911_10531641All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300032052|Ga0318506_10502683All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300032076|Ga0306924_10261244All Organisms → cellular organisms → Bacteria → Acidobacteria1988Open in IMG/M
3300032261|Ga0306920_100917332All Organisms → cellular organisms → Bacteria → Acidobacteria1280Open in IMG/M
3300032770|Ga0335085_10543011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1319Open in IMG/M
3300032954|Ga0335083_10210339All Organisms → cellular organisms → Bacteria → Acidobacteria1771Open in IMG/M
3300033158|Ga0335077_11626441All Organisms → cellular organisms → Bacteria613Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.70%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.90%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.90%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026760Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes)EnvironmentalOpen in IMG/M
3300026819Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes)EnvironmentalOpen in IMG/M
3300027042Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_083553002170459002Grass SoilVRWGTISQIDYDELQYADNVDEAFEAVRSGLEKYHMNVDPFLQAY
JGIcombinedJ26739_10095949713300002245Forest SoilFDNLQYADSVDEAFDKIRMGLEKYHMQGDPFLQAY*
JGI25614J43888_1020576213300002906Grasslands SoilEVLNLKNMLRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEAEPFLQAY*
JGI25616J43925_1029320613300002917Grasslands SoilKNMVRWGTISQADFDNLQYADSVDEAFDKIRVGLEKYHMQGDPFLQAY*
Ga0070706_10082441423300005467Corn, Switchgrass And Miscanthus RhizosphereVRWGMISASEYGLLQFADNVDDAFEVIRAGLEKYHMEVDPFLQAY*
Ga0070697_10212745623300005536Corn, Switchgrass And Miscanthus RhizosphereWGMINQNEYDMLQFSDNVDDAFQRIRSGLEKYHMELSSEL*
Ga0070730_1073205823300005537Surface SoilEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY*
Ga0070762_1025324713300005602SoilAMVNWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY*
Ga0070766_1020395043300005921SoilNWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY*
Ga0075029_10092841813300006052WatershedsGTISQADFDNLQYADTVEEAFDKIRMGLEKYHMQVDPFLQAY*
Ga0075017_10096541533300006059WatershedsINQSEYDLLQFADTVDEAFDVVRAGLEKYHMQVDPFLQAY*
Ga0070765_10084963713300006176SoilKAMVRWGMINQNEYKLLKFADTPDEAFDIIHTELENYHMQVDPFLQAY*
Ga0075434_10090956313300006871Populus RhizosphereGLLQFADNVDDAFEVIRAGLEKYHMEVDPFLQAY*
Ga0075426_1062436313300006903Populus RhizosphereVRWGTINEQEYEMLQFADNVDEAFDRVRAGLEKYHMNVDPFLQAY*
Ga0099791_1009197933300007255Vadose Zone SoilEYKMLQFADTVDEAFDHIRAGLEKYHMDADSFLQAY*
Ga0099793_1047641423300007258Vadose Zone SoilKMLQFADTVDEAFDHIRAGLEKYHMDLDPFLQAY*
Ga0099794_1014588513300007265Vadose Zone SoilNEYKMLQFADTVDEAFDHIRAGLEKYHMDADSFLQAY*
Ga0066710_10488604513300009012Grasslands SoilEDEYKLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY
Ga0126374_1173736013300009792Tropical Forest SoilNPDEFKLLKFADTVEDAFNVVRATLEKYHMEVDPFLQTY*
Ga0126373_1268312523300010048Tropical Forest SoilPSEYGLLQFADTVDDAFEVIRAGLERYHMEVDPFLQAY*
Ga0134082_1044667813300010303Grasslands SoilYNMLQFADTVDEAFDYNRAGLEKYHMEPDPFLRA*
Ga0134111_1032257813300010329Grasslands SoilKLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY*
Ga0074046_1020447633300010339Bog Forest SoilLNFRAMVRWGMISQNEYGLIQYADTVEEAFEKIRTGMEKYHMEVDPFLQAY*
Ga0126378_1097542413300010361Tropical Forest SoilKLLQFADDVDEAFDRIRAGLEKYHMGVDPFLQAY*
Ga0126378_1326344413300010361Tropical Forest SoilYEMLQFADTVDEAFDRIRAGLEKYHMDAEPFLQAY*
Ga0126377_1041516813300010362Tropical Forest SoilEYKLLQFADNVDEAFDLVRAAMEKYHMDVDPFLQAY*
Ga0126381_10461685623300010376Tropical Forest SoilYEMLQFADTVEEAFDRIRAGLEKYHMDAEPFLQAY*
Ga0136449_10249927033300010379Peatlands SoilEEYKMLKFADTVDEAFDHIRAGLEKYHMDTDSFLQAY*
Ga0126356_1110729113300010877Boreal Forest SoilNEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY*
Ga0137391_1098496923300011270Vadose Zone SoilKLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY*
Ga0137393_1006153953300011271Vadose Zone SoilEDEYKMLQFADTVDEAFDHIRAGLEKYHMDLDPFLQAY*
Ga0137393_1010526713300011271Vadose Zone SoilEEYKMLQFADTVDEAFDHIRAGLEKYHMDGDPFLQAY*
Ga0137393_1115152113300011271Vadose Zone SoilINEAEYKLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY*
Ga0137389_1096701623300012096Vadose Zone SoilYKMLQFADNVEEAFDRIRAGLEKYHMGVEPFLQAY*
Ga0137388_1031590933300012189Vadose Zone SoilVLKLKNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY*
Ga0137388_1054837113300012189Vadose Zone SoilDEYKMLQFADTVDEAFDHIRAGLEKYHMGVDAFLQAY*
Ga0137388_1070667113300012189Vadose Zone SoilVNEEEYKMLQFADNVEEAFDRIRAGLEKYHMGVEPFLQAY*
Ga0137362_1046431433300012205Vadose Zone SoilKMLQFADTVDEAFDRIRAGLEKYHMDGDPFLQAY*
Ga0137360_1019581413300012361Vadose Zone SoilDFDNLQYADSVDEAFDKIRVGLEKYHMKGDPFLQAY*
Ga0137390_1080339013300012363Vadose Zone SoilRAMVRWRTNNEEEYNMLQLADTVDDAFERIRGGLEKYHMQVDPFLQAY*
Ga0137396_1045252813300012918Vadose Zone SoilIDDEEHNLLQFADNVDEAFDLIRSGLEKYLMEVDPFLQTY*
Ga0137396_1104490723300012918Vadose Zone SoilEYKMLLFADTVDEAFDHIRAGLEKYHMDGDPFLQAY*
Ga0134079_1043513023300014166Grasslands SoilEYKLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY*
Ga0137405_104935313300015053Vadose Zone SoilICRYRRKMLQFADTVDEAFDHIRAGLEKYHMGVDAFLQAY*
Ga0137420_100224833300015054Vadose Zone SoilKMLQFADTVDDAFDHIRAGLEKYHMDADPFLQAY*
Ga0137418_1059991913300015241Vadose Zone SoilENEYKMLQFADTVEEAFDHIRAGLEKYHMDADPFLQAY*
Ga0137403_1094796223300015264Vadose Zone SoilKMLQFADTVDEAFDHIRAGLEKYHMDADPFLQAY*
Ga0182041_1058647113300016294SoilQEEYDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY
Ga0182035_1119832813300016341SoilLHLKAMERWGMINPDEFKLLKFADTVEEAFNVVRATLERYHMEVDPFLQTY
Ga0182039_1087788713300016422SoilYDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY
Ga0182039_1111178913300016422SoilKAMVRWGTISQIDYDQLQYADNVDEAFEAVRSGLEKYHMNVDPFLQAY
Ga0187802_1004189113300017822Freshwater SedimentQTEFDQLQFADNVDEAFEVIRAGLEKYHMEVDPFLQAY
Ga0187778_1101372613300017961Tropical PeatlandITEEEYKMLQFADSVDEAFDLIRAGLEKYHMDVDPFLQAY
Ga0187810_1020261113300018012Freshwater SedimentTITEEEYRLLKFADNVDEAFDHIRSGLEKYHMKVDSFLQAY
Ga0187874_1047450523300018019PeatlandQSEYNMLQFADTVDEAFERIQSGLEKYHLEIESDL
Ga0187797_146947613300019284PeatlandNEAEYKMLQFADNVDEAFDRVRAGLEKYHMRVDSFLQAY
Ga0215015_1045164133300021046SoilRWGMINQDEYKMLQFADPVDEAFARIREGLEKYHMELNSDL
Ga0210406_1072909323300021168SoilDEEEHKLLKFADTVDEAFDHIRSGLEKYHMEVDPFLQAY
Ga0210406_1129022113300021168SoilEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210393_1129936413300021401SoilWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210386_1103260913300021406SoilWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY
Ga0210386_1173337013300021406SoilKNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMQGDPFLQAY
Ga0210383_1137684613300021407SoilEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210384_1158448923300021432SoilNEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210391_1033279333300021433SoilMVNWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210391_1097231623300021433SoilLNWKAMVKWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0210392_1105261223300021475SoilNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY
Ga0210402_1093582813300021478SoilEYKMLQFADTVDDAFDYIRGGLEKYHMNVDPFLQTY
Ga0210402_1109358113300021478SoilNEDEYKMLQFADTVDEAFDHIRGGLEKYHMDVDPFLQTY
Ga0210409_1116976713300021559SoilFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY
Ga0126371_1070037213300021560Tropical Forest SoilSSEYKLLKFADTVDEAFNVVRATLEKYHMEVDPFLQTY
Ga0242662_1035686913300022533SoilEEEYKMLQFADSVDEAFDHIRAGLEKYHMDVDPFMQAY
Ga0242654_1026058123300022726SoilYKMLQFADTVDEAFDHIRAGLEKYHMDADPFLQAY
Ga0247668_108317413300024331SoilINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0207646_1050582433300025922Corn, Switchgrass And Miscanthus RhizosphereAEYKLLQFADNVDDAFDVIRSGLEKYHMEVDPVLQAY
Ga0257158_105019423300026515SoilNENEYKMLQFADTVDEAFDYIRAGLEKYHMDGDPFLQAY
Ga0209577_1087085213300026552SoilEAEYKLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY
Ga0207630_10468223300026760SoilTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0207765_11801213300026819Tropical Forest SoilWGTINQEEYDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY
Ga0207766_101346833300027042Tropical Forest SoilQEEYDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY
Ga0209274_1055799613300027853SoilEEYKMLQFADSVDEAFDHIRAGLEKYHMEIDPFLQAY
Ga0209693_1043315013300027855SoilNWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0209067_1000867813300027898WatershedsSEYRMLQFADTVDEAFDHIRAGLEKYHMEVDPFLYAY
Ga0209488_1040156723300027903Vadose Zone SoilYKLLQFADTVDEAFDRIRAGLEKYHMRGEPFLQAY
Ga0222749_1003580343300029636SoilKLKNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY
Ga0265753_106584523300030862SoilVNWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY
Ga0318516_1085071723300031543SoilQNEYDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY
Ga0318515_1003397553300031572SoilVRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0307483_101195613300031590Hardwood Forest SoilEEYKMLQFADTVDEAFDYIRAGLEKYHMEGEQFLQAY
Ga0318572_1085110613300031681SoilTISPSEYGLLKFADTVDDAFEVIRAGLERYHMEVDPFLQAY
Ga0307476_1108023923300031715Hardwood Forest SoilEDEYKMLQFADSVDEAFDLIRAGLEKYHMEVDPFLQAY
Ga0307469_1109816323300031720Hardwood Forest SoilLNLKAMVRWGTINQNEYNLLQYADTPEEAFNLIRAGLEKYHMEVDPFLQAY
Ga0306918_1040255133300031744SoilYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0307475_1125123813300031754Hardwood Forest SoilMVDAGTINEEEYKMLQFADSVDEAFDHIRASLEKYHMEVDPFLQAY
Ga0318535_1008946643300031764SoilWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0318535_1043602613300031764SoilLRWGTISQEDFDNLQYADSVDEAFEKIRMGLEKYHMQVDPFLQAY
Ga0318509_1022183013300031768SoilEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0307473_1090335523300031820Hardwood Forest SoilQIDYDELQYADNVDEAIEAERSGLEKYHMNVDPFLQAY
Ga0318522_1017067613300031894SoilLKGMVRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0306923_1168673623300031910SoilGTINQEEYDLLQYADNVDEAFEVIRSGLEKYHMEADPILQAY
Ga0306921_1198680813300031912SoilTISQIDYDQLQYADNVDEAFEAVRSGLEKYHMDVDPFLQAY
Ga0306921_1199975013300031912SoilMVRWGTINQEEYDLLQYADTVAEAFEVIRSGLEKYHMEIDPFLQTY
Ga0306926_1074960113300031954SoilFDQLQFADNVDEAFELIRFGLEKYHMEVDPFLQAY
Ga0306922_1071709613300032001SoilYDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY
Ga0310911_1053164113300032035SoilQEEYDLLQYADTVDEAFEVIRSGLEKYHMEIDPFLQAY
Ga0318506_1050268323300032052SoilINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0306924_1026124413300032076SoilGMVRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY
Ga0306920_10091733213300032261SoilVLKLKNMVRWGTISQEDFDNLQYADSVDEAFDKIRMGLEKYHMQVDPFLQAY
Ga0335085_1054301113300032770SoilNESEYKLLQFADNVDEAFDIVRSGLEKYHMEVDPFLQAY
Ga0335083_1021033913300032954SoilINQQEYEKLEFADTVDEAFDVIRAGLEKYHMQVDPFLQAY
Ga0335077_1162644113300033158SoilNEYDLLQYADTVDEAFEVIRSGLEKYHMQVDPFLQAY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.