NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085514

Metagenome / Metatranscriptome Family F085514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085514
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 45 residues
Representative Sequence MEPKVLRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHGRW
Number of Associated Samples 94
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.39 %
% of genes near scaffold ends (potentially truncated) 27.03 %
% of genes from short scaffolds (< 2000 bps) 72.07 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.297 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(15.315 % of family members)
Environment Ontology (ENVO) Unclassified
(21.622 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.243 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.73%    β-sheet: 0.00%    Coil/Unstructured: 52.27%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF00355Rieske 36.04
PF00550PP-binding 13.51
PF12831FAD_oxidored 5.41
PF00582Usp 1.80
PF08028Acyl-CoA_dh_2 1.80
PF05494MlaC 1.80
PF01040UbiA 0.90
PF00296Bac_luciferase 0.90
PF02538Hydantoinase_B 0.90
PF07040DUF1326 0.90
PF00571CBS 0.90
PF02668TauD 0.90
PF01850PIN 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 1.80
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.80
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 1.80
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.90
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.90
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.30 %
UnclassifiedrootN/A2.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004267|Ga0066396_10022368All Organisms → cellular organisms → Bacteria → Proteobacteria863Open in IMG/M
3300004633|Ga0066395_10492855All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium705Open in IMG/M
3300005174|Ga0066680_10055882All Organisms → cellular organisms → Bacteria → Proteobacteria2329Open in IMG/M
3300005180|Ga0066685_10001551All Organisms → cellular organisms → Bacteria10041Open in IMG/M
3300005332|Ga0066388_100021566All Organisms → cellular organisms → Bacteria5673Open in IMG/M
3300005332|Ga0066388_101202352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1296Open in IMG/M
3300005355|Ga0070671_101292406All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium643Open in IMG/M
3300005440|Ga0070705_100753984All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005440|Ga0070705_101348610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium593Open in IMG/M
3300005444|Ga0070694_100506133All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium962Open in IMG/M
3300005446|Ga0066686_10018971All Organisms → cellular organisms → Bacteria → Proteobacteria3812Open in IMG/M
3300005447|Ga0066689_10175831All Organisms → cellular organisms → Bacteria → Proteobacteria1286Open in IMG/M
3300005447|Ga0066689_10802186All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005518|Ga0070699_100143272All Organisms → cellular organisms → Bacteria → Proteobacteria2111Open in IMG/M
3300005526|Ga0073909_10338713Not Available694Open in IMG/M
3300005526|Ga0073909_10416779All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005546|Ga0070696_100161257All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300005764|Ga0066903_100375743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2319Open in IMG/M
3300005844|Ga0068862_102763359All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300005983|Ga0081540_1190173Not Available758Open in IMG/M
3300006049|Ga0075417_10054767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1732Open in IMG/M
3300006755|Ga0079222_11931515All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300006845|Ga0075421_102292866All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006852|Ga0075433_10149848All Organisms → cellular organisms → Bacteria → Proteobacteria2075Open in IMG/M
3300006853|Ga0075420_100041254All Organisms → cellular organisms → Bacteria4120Open in IMG/M
3300006854|Ga0075425_100968248All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium971Open in IMG/M
3300006871|Ga0075434_101667655All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300006904|Ga0075424_101150503All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium826Open in IMG/M
3300006904|Ga0075424_101281342All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium779Open in IMG/M
3300006914|Ga0075436_100232170All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300007255|Ga0099791_10108139All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300009094|Ga0111539_10003740All Organisms → cellular organisms → Bacteria20021Open in IMG/M
3300009100|Ga0075418_11009221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium901Open in IMG/M
3300009147|Ga0114129_10016349All Organisms → cellular organisms → Bacteria10562Open in IMG/M
3300009147|Ga0114129_10103948All Organisms → cellular organisms → Bacteria3926Open in IMG/M
3300009174|Ga0105241_12079426All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010043|Ga0126380_10247046All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1232Open in IMG/M
3300010046|Ga0126384_10457258All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1091Open in IMG/M
3300010154|Ga0127503_10198154All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium672Open in IMG/M
3300010304|Ga0134088_10005217All Organisms → cellular organisms → Bacteria5389Open in IMG/M
3300010335|Ga0134063_10107083All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300010335|Ga0134063_10612548All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300010336|Ga0134071_10000022All Organisms → cellular organisms → Bacteria36830Open in IMG/M
3300010359|Ga0126376_10542330All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1087Open in IMG/M
3300010360|Ga0126372_11263344All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300010362|Ga0126377_11192499All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium832Open in IMG/M
3300010366|Ga0126379_10494327All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1294Open in IMG/M
3300010366|Ga0126379_12429597All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010397|Ga0134124_10090906All Organisms → cellular organisms → Bacteria2640Open in IMG/M
3300010398|Ga0126383_11027865All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium913Open in IMG/M
3300010401|Ga0134121_10401969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1238Open in IMG/M
3300011271|Ga0137393_10061565All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2965Open in IMG/M
3300012199|Ga0137383_11162603All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300012202|Ga0137363_10719418All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300012202|Ga0137363_11719036All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300012211|Ga0137377_10877896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium829Open in IMG/M
3300012358|Ga0137368_10126944All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1922Open in IMG/M
3300012393|Ga0134052_1020217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium610Open in IMG/M
3300012403|Ga0134049_1351590All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium748Open in IMG/M
3300012407|Ga0134050_1217144All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium807Open in IMG/M
3300012410|Ga0134060_1486517All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium631Open in IMG/M
3300012685|Ga0137397_10371985All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300012917|Ga0137395_10358913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1039Open in IMG/M
3300012922|Ga0137394_10367777All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300012922|Ga0137394_10706510All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium848Open in IMG/M
3300012944|Ga0137410_11196312All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012948|Ga0126375_10033625All Organisms → cellular organisms → Bacteria2575Open in IMG/M
3300012976|Ga0134076_10003038All Organisms → cellular organisms → Bacteria → Proteobacteria5289Open in IMG/M
3300012986|Ga0164304_10200001All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300015371|Ga0132258_12408769All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1318Open in IMG/M
3300015371|Ga0132258_12449688All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1306Open in IMG/M
3300015371|Ga0132258_13895696All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1015Open in IMG/M
3300015372|Ga0132256_100145982All Organisms → cellular organisms → Bacteria2367Open in IMG/M
3300016422|Ga0182039_10554463All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300017997|Ga0184610_1186549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium690Open in IMG/M
3300018074|Ga0184640_10099311All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1265Open in IMG/M
3300018433|Ga0066667_10531157All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium973Open in IMG/M
3300020170|Ga0179594_10033206All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1661Open in IMG/M
3300021476|Ga0187846_10326010All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium634Open in IMG/M
3300025937|Ga0207669_10375625All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1106Open in IMG/M
3300026285|Ga0209438_1171791Not Available570Open in IMG/M
3300026285|Ga0209438_1209108All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300026297|Ga0209237_1009655All Organisms → cellular organisms → Bacteria → Proteobacteria5776Open in IMG/M
3300026297|Ga0209237_1013386All Organisms → cellular organisms → Bacteria4852Open in IMG/M
3300026313|Ga0209761_1034232All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3013Open in IMG/M
3300026317|Ga0209154_1039887All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300026324|Ga0209470_1000087All Organisms → cellular organisms → Bacteria63830Open in IMG/M
3300026328|Ga0209802_1095155All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1351Open in IMG/M
3300026538|Ga0209056_10052236All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3647Open in IMG/M
3300027646|Ga0209466_1003158All Organisms → cellular organisms → Bacteria3398Open in IMG/M
3300027821|Ga0209811_10113090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium984Open in IMG/M
3300027873|Ga0209814_10000623All Organisms → cellular organisms → Bacteria11873Open in IMG/M
3300027873|Ga0209814_10020161All Organisms → cellular organisms → Bacteria2698Open in IMG/M
3300027880|Ga0209481_10104819All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1369Open in IMG/M
3300027907|Ga0207428_10000018All Organisms → cellular organisms → Bacteria293117Open in IMG/M
3300028381|Ga0268264_12220798All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300028536|Ga0137415_10169432All Organisms → cellular organisms → Bacteria → Proteobacteria2014Open in IMG/M
3300031543|Ga0318516_10219166All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1100Open in IMG/M
3300031544|Ga0318534_10009405All Organisms → cellular organisms → Bacteria → Proteobacteria4843Open in IMG/M
3300031546|Ga0318538_10267644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium919Open in IMG/M
3300031720|Ga0307469_10125663All Organisms → cellular organisms → Bacteria1866Open in IMG/M
3300031720|Ga0307469_10730609All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium901Open in IMG/M
3300031720|Ga0307469_10920971All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium811Open in IMG/M
3300031740|Ga0307468_100806677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium801Open in IMG/M
3300031792|Ga0318529_10240148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium843Open in IMG/M
3300031846|Ga0318512_10056788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1761Open in IMG/M
3300031858|Ga0310892_10154658All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1334Open in IMG/M
3300032043|Ga0318556_10331439All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300032094|Ga0318540_10661165All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300032770|Ga0335085_12116004All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300033433|Ga0326726_10094815All Organisms → cellular organisms → Bacteria2662Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.60%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.90%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.90%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066396_1002236823300004267Tropical Forest SoilMARTSVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHRHGRW*
Ga0066395_1049285513300004633Tropical Forest SoilMARTCVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHRHGHW*
Ga0066680_1005588243300005174SoilMLRRLGVMFLLACVVSISTAGCLLVPFPVGGGGGHHHRDRGRW*
Ga0066685_1000155143300005180SoilMANDWASALGATFLLACVVGISTAGCLLVPVPVGSGRGYHHHGRW*
Ga0066388_10002156653300005332Tropical Forest SoilMARTRVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHHHGRW*
Ga0066388_10120235223300005332Tropical Forest SoilMNQVLQRRINMLRRLGVTFLLACVVSITTAGCLLVPVPVGGGGHHHRGRW*
Ga0070671_10129240613300005355Switchgrass RhizosphereMERPKVLRRMATMFLLACLVTLSTAGCLLVPVPVGPGHGYHHRW*
Ga0070705_10075398423300005440Corn, Switchgrass And Miscanthus RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW*
Ga0070705_10134861023300005440Corn, Switchgrass And Miscanthus RhizosphereMERPKVLRRLTTMFLLACLVTLSTAGCLLVPVPVGPGHGYHHRW*
Ga0070694_10050613313300005444Corn, Switchgrass And Miscanthus RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPVPVGSGHGYHHGRW*
Ga0066686_1001897113300005446SoilMARTTGLRRLGATFLLACVVGISTAGCLLVPVPVGSGRGYHHHGRW*
Ga0066689_1017583123300005447SoilMLRRLGVMFLLAGVVSISTAGCLLVPFPVGWGGGHHHRDRGRW*
Ga0066689_1080218623300005447SoilGKNDWASALGATFLLACVVGISTAGCLLVPVPVGSGRGYHHHGRW*
Ga0070699_10014327233300005518Corn, Switchgrass And Miscanthus RhizosphereMLRRLGVMFLLACVVSISTAGCLLVPFPVGWGGGHHHRDRGRW*
Ga0073909_1033871313300005526Surface SoilTMFLLACVVTISTAGCLLVPVPVGSGHGYHHGRW*
Ga0073909_1041677923300005526Surface SoilMERPNMLRRLAATFLLACVVTISTAGCLLVPIPVGGGHGGYHHRGRW*
Ga0070696_10016125743300005546Corn, Switchgrass And Miscanthus RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGRGGYHQHGRW*
Ga0066903_10037574343300005764Tropical Forest SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGYHHRW*
Ga0068862_10276335913300005844Switchgrass RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGHGGY
Ga0081540_119017323300005983Tabebuia Heterophylla RhizosphereMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW*
Ga0075417_1005476723300006049Populus RhizosphereVREMNHMLLQRRIETMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW*
Ga0079222_1193151523300006755Agricultural SoilMERPKMLRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHRW*
Ga0075421_10229286613300006845Populus RhizosphereGVMFLLACVVSISTAGCLLVPVPVGGGSHHHRGRW*
Ga0075433_1014984833300006852Populus RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGGHGGYHHRGRW*
Ga0075420_10004125463300006853Populus RhizosphereMLRRLGVMFLLACVVSISTAGCLLVPVPVGGGGHHHRGRW*
Ga0075425_10096824813300006854Populus RhizosphereMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPGHGYHHRW*
Ga0075434_10166765513300006871Populus RhizosphereMERPKILRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHRW*
Ga0075424_10115050323300006904Populus RhizosphereATMFLLACVVTISTAGCLLVPVPVGPGHGYHHRW*
Ga0075424_10128134213300006904Populus RhizosphereMERPKMLRRLATMFLLACVVTISTAGCLLVPVPVGP
Ga0075436_10023217013300006914Populus RhizosphereSRRLETMERPKMLRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHRW*
Ga0099791_1010813913300007255Vadose Zone SoilMARTTVLRRLGATFLLACVVGITTAGCLLVPVPVGPGRGYYRHGRW*
Ga0111539_1000374053300009094Populus RhizosphereMLRRLGVMFLLACVVSISTAGCLLVPVPVGGGSHHHRGRW*
Ga0075418_1100922123300009100Populus RhizosphereMNHMLLQRRSETMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW*
Ga0114129_10016349133300009147Populus RhizosphereMNHMLLQRRIETMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW*
Ga0114129_1010394823300009147Populus RhizosphereMARSSVLRRLGATFLLACLVTISTAGCLLVPVPVGGHGGYHRGRW*
Ga0105241_1207942613300009174Corn RhizosphereLRRLATMFLLACLVTISTAGCLLVPIPVGPGHGYHHRW*
Ga0126380_1024704633300010043Tropical Forest SoilMARTTVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGSHHHGRW*
Ga0126384_1045725823300010046Tropical Forest SoilMARTSVLRRLGATLLLACVVGVSTAGCLLVPVPVGPGRGYHHHGRW*
Ga0127503_1019815423300010154SoilMEPKALRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW*
Ga0134088_1000521763300010304Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTSGCLLVPVPVGGGGGRHHHRGDRW*
Ga0134063_1010708343300010335Grasslands SoilMARTTGLRRLGATFLLACVVGISTAGCLLVPVPVGSG
Ga0134063_1061254823300010335Grasslands SoilMLRRLGVMFLLACVVSISTAGCLLVPFPVGGGGGHHHHDRGRW*
Ga0134071_10000022283300010336Grasslands SoilMARTTGLRRLGATFLLACFVGISTAGCLLVPVPVGSGRGYHHHGRW*
Ga0126376_1054233023300010359Tropical Forest SoilMARTSVLRRLGATFLLACVVGISTAGCLLVTVPVGPGRGYHRHGHW*
Ga0126372_1126334423300010360Tropical Forest SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPGHGFHHRW*
Ga0126377_1119249913300010362Tropical Forest SoilMNQLLRQRRIKMLRRLGVAFLLACVVSISTAGCLLVPVPVGGGYHHHRGRW*
Ga0126379_1049432743300010366Tropical Forest SoilMERPKVLRRLATMFLLACLVTITTAGCLLVPVPVGPAHGYHHRW*
Ga0126379_1242959713300010366Tropical Forest SoilMHKNLLRRLETMARTRVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHHHGRW*
Ga0134124_1009090633300010397Terrestrial SoilVRRIETMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW*
Ga0126383_1102786513300010398Tropical Forest SoilMERPKVLPRLATMFLLACLVTITTAGCLLVPVPVGPAHGYHHRW*
Ga0134121_1040196923300010401Terrestrial SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPIPVGPGHGYHHRW*
Ga0137393_1006156533300011271Vadose Zone SoilMLRSSTLRRLGAMLLLACVVTISTSGCLLVPVPVDGGGGHHHHRDRDRW*
Ga0137383_1116260323300012199Vadose Zone SoilMERPNVLRRLAATFLLACVVTISTAGCLLVPVPVGGGHGGYHHRGRW*
Ga0137363_1071941823300012202Vadose Zone SoilMARSNVLRRLGVMFLLACVVSISTAGCLLVPIPVGGGYHHHRGRW*
Ga0137363_1171903613300012202Vadose Zone SoilMERKALRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW*
Ga0137377_1087789643300012211Vadose Zone SoilMERPNVLRRLAATFLLACVVTISTAGCLLVPVPVGGGHGGYHHR
Ga0137368_1012694413300012358Vadose Zone SoilMLRSSTLRRLGAMLLLACVVTISTSGCLMVPVPVGGGGGRPHHR
Ga0134052_102021713300012393Grasslands SoilMLRSSTLRRLGAMLSLACVVTISTSGCLLVPVPVGGGGGHHHHRD
Ga0134049_135159013300012403Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTAGCLLVPFPVGGGGGHHHHRGRW*
Ga0134050_121714413300012407Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTAGCLLVPFPVGGGGGRHHHRGDRW*
Ga0134060_148651723300012410Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTSGCLLVPVPVGGGGG
Ga0137397_1037198513300012685Vadose Zone SoilATFLLACVVGITTAGCLLVPVPVGPGRGYYRHGRW*
Ga0137395_1035891323300012917Vadose Zone SoilMERKALRRLATMFLLACVVTISTAGCLLVPVPVGGGHGGYHHRGRW*
Ga0137394_1036777723300012922Vadose Zone SoilMARTTVLRRLGATFLLACVVGITTAGCLLVPVPVPVGPGRGYHRHGRW*
Ga0137394_1070651023300012922Vadose Zone SoilMARTTVLRRLGATFLLACIVGITTAGCLLVPVPVGPGRGYYRHGRW*
Ga0137410_1119631213300012944Vadose Zone SoilNNTSQLRRIETMERKALRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW*
Ga0126375_1003362543300012948Tropical Forest SoilMARTTVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHHHGRW*
Ga0134076_1000303873300012976Grasslands SoilMMARTTVLRRLGATFLLACVVGITTAGCLLVPVPVGPGRGYHRHGRW*
Ga0164304_1020000143300012986SoilMLRRLAATFLLACVVTISTAGCLLVPIPVGGGHGGYHHRGRW*
Ga0132258_1240876923300015371Arabidopsis RhizosphereMERPKMLRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHR*
Ga0132258_1244968823300015371Arabidopsis RhizosphereMERPKMLRRLATIFVLACAVTISTAGCLLVPVPVGGGHGYHHR*
Ga0132258_1389569633300015371Arabidopsis RhizosphereMEPKGLRRLATMFLLACVVTIGTAGCLLVPVPVGPGHGYHHGRW*
Ga0132256_10014598243300015372Arabidopsis RhizosphereMERPKMLRRLATIFVLACAVTISTAGGLLVPVPVGGGHGYHHR*
Ga0182039_1055446313300016422SoilITARRLETMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGYHHRW
Ga0184610_118654913300017997Groundwater SedimentMLRSSTLRRLGAMLLLACVVTISTSGCLLVPVPVGGGGGRHH
Ga0184640_1009931113300018074Groundwater SedimentMLRSSTLRRLGAMLLLACVVTISTSGCLLVPVPVGGGGGHRHHHRDRDRWQRHAGTPHC
Ga0066667_1053115713300018433Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTAGCLLVPFPVGGGGGHHHHRGRW
Ga0179594_1003320623300020170Vadose Zone SoilMARSNVLRRLGVMFLLACVVSISTAGCLLVPIPVGGGYHHHRGRW
Ga0187846_1032601023300021476BiofilmMARTTILRRLGVTLLLACVVGIGTAGCLLVPVPVGPGWHHHGRW
Ga0207669_1037562543300025937Miscanthus RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPVPVGS
Ga0209438_117179113300026285Grasslands SoilMERPNVLRRLAATFLLACVVTISTAGCLLVPVPAGGGHGGYHHRGRW
Ga0209438_120910813300026285Grasslands SoilMARPSVLRRLAATFLLACVVGISTAGCLLVPIPVGG
Ga0209237_100965553300026297Grasslands SoilMLRSSTLRRLSAMLLLACVVTISTSGCLLVPFPVGGGGHHHHRGRW
Ga0209237_101338613300026297Grasslands SoilMLRRLGVMFLLACVVSISTAGCLLVPFPVGGGGGHHHRDRGRW
Ga0209761_103423243300026313Grasslands SoilMLRSSTLRRLGAMLLLACVVTISTAGCLVPFPVGGGGGHHHHRGRW
Ga0209154_103988743300026317SoilMLRRLGVIFLLACVVSISTAGCLLVPFPVGWGGGH
Ga0209470_1000087443300026324SoilMARTTGLRRLGATFLLACVVGISTAGCLLVPVPVGSGRGYHHHGRW
Ga0209802_109515533300026328SoilMLRRLGVMFLLAGVVSISTAGCLLVPFPVGWGGGHHHRDRGRW
Ga0209056_1005223663300026538SoilMLRRLGVIFLLACVVSISTAGCLLVPFPVGWGGGHHHR
Ga0209466_100315833300027646Tropical Forest SoilMARTTVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHHHGRW
Ga0209811_1011309023300027821Surface SoilMERPNMLRRLAATFLLACVVTISTAGCLLVPIPVGGGHGGYHHRGRW
Ga0209814_10000623133300027873Populus RhizosphereMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW
Ga0209814_1002016133300027873Populus RhizosphereMLRRLGVMFLLACVVSISTAGCLLVPVPVGGGGHHHRGRW
Ga0209481_1010481913300027880Populus RhizosphereMNHMLLQRRIETMTRSNVFRRLGVMFLLACVVSISTAGCLLVPVPVGGGHRHHGRW
Ga0207428_10000018613300027907Populus RhizosphereMLRRLGVMFLLACVVSISTAGCLLVPVPVGGGSHHHRGRW
Ga0268264_1222079823300028381Switchgrass RhizosphereMEPKVLRRLATMFLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW
Ga0137415_1016943223300028536Vadose Zone SoilMARPSVLRRLGVMFLLACVVSISTAGCLLVPVPVGGGHHHHRGRW
Ga0318516_1021916633300031543SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGYHHRW
Ga0318534_1000940533300031544SoilMARTSVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGYHRHGRW
Ga0318538_1026764433300031546SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGYH
Ga0307469_1012566343300031720Hardwood Forest SoilMARTTVLRRLGATFLLACVVGISTAGCLLVPVPVGPGRGWHHHGRW
Ga0307469_1073060923300031720Hardwood Forest SoilMEPKVLRRLATMFLLACVVTISTAGCLLVPVPVGPGHGYHHGRW
Ga0307469_1092097123300031720Hardwood Forest SoilMQRPNVLRRLAATVLLACVVTISTAGCLLVPFPVGGHGGYHHRGRW
Ga0307468_10080667723300031740Hardwood Forest SoilMARTTVLRRLGATFLLACVVGITTAGCLLVPVPVGPGRGYHRHGRW
Ga0318529_1024014813300031792SoilMERPNVLRRLATMFLLACLVTISTAGCLLVPVPVGPGHGYHHRW
Ga0318512_1005678813300031846SoilLVTMRITARRLETMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGYHHRW
Ga0310892_1015465823300031858SoilMERPNMLRRLAATVLLACVVTISTAGCLLVPIPVGGGHGGYHHRGRW
Ga0318556_1033143923300032043SoilMERPKVLRRLATMFLLACLVTISTAGCLLVPVPVGPAHGY
Ga0318540_1066116513300032094SoilLATMFLLACLVTISTAGCLLVPVPVGPAHGYHHRW
Ga0335085_1211600413300032770SoilMERPKMLRRLATMFLLACAVTISTAGCLLVPVPVGGGHGY
Ga0326726_1009481533300033433Peat SoilMEAKALRRLATMFLLACVVTISTAGCLLVPIPVGGHGGYHHHGRW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.