NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085498

Metagenome Family F085498

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085498
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 48 residues
Representative Sequence GGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRVRMLAGR
Number of Associated Samples 88
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.79 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.099 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(12.613 % of family members)
Environment Ontology (ENVO) Unclassified
(45.946 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(72.072 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 7.79%    Coil/Unstructured: 92.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF13594Obsolete Pfam Family 11.71
PF01979Amidohydro_1 8.11
PF13147Obsolete Pfam Family 7.21
PF00293NUDIX 2.70
PF13520AA_permease_2 1.80
PF01593Amino_oxidase 0.90
PF00510COX3 0.90
PF06452CBM9_1 0.90
PF06964Alpha-L-AF_C 0.90
PF13229Beta_helix 0.90
PF13450NAD_binding_8 0.90
PF07969Amidohydro_3 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.90
COG3534Alpha-L-arabinofuranosidaseCarbohydrate transport and metabolism [G] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.10 %
UnclassifiedrootN/A0.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_483301All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300000559|F14TC_108773112All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300000891|JGI10214J12806_11193339All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium511Open in IMG/M
3300000955|JGI1027J12803_102758065All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300004156|Ga0062589_102703561All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium516Open in IMG/M
3300004479|Ga0062595_100741602All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300004480|Ga0062592_102504026All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300004643|Ga0062591_101147140All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005290|Ga0065712_10025833All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300005293|Ga0065715_10102156All Organisms → cellular organisms → Bacteria3110Open in IMG/M
3300005293|Ga0065715_10749638Not Available617Open in IMG/M
3300005294|Ga0065705_10069661All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005294|Ga0065705_10409222All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300005336|Ga0070680_100966233All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300005336|Ga0070680_101811677All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005340|Ga0070689_100217570All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300005356|Ga0070674_101500266All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005438|Ga0070701_11069414All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005440|Ga0070705_100335250All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300005444|Ga0070694_101079473All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium669Open in IMG/M
3300005468|Ga0070707_101956063All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005518|Ga0070699_101570653All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005545|Ga0070695_101504211All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005577|Ga0068857_100783634All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005577|Ga0068857_101279788All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005614|Ga0068856_100484401All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300005617|Ga0068859_100958625All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005618|Ga0068864_101664985All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005834|Ga0068851_10626244All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005841|Ga0068863_102269466All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005841|Ga0068863_102375919All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005843|Ga0068860_100044661All Organisms → cellular organisms → Bacteria4223Open in IMG/M
3300005843|Ga0068860_100089737All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2927Open in IMG/M
3300005843|Ga0068860_100776716All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005844|Ga0068862_101074682All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005983|Ga0081540_1238682All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300006034|Ga0066656_10095846All Organisms → cellular organisms → Bacteria → Acidobacteria1794Open in IMG/M
3300006791|Ga0066653_10071986All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006804|Ga0079221_11436757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300006845|Ga0075421_101859495All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300006852|Ga0075433_10324457All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300006852|Ga0075433_10517756All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300006852|Ga0075433_10836592All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300006880|Ga0075429_100219877All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300006880|Ga0075429_101896903All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006904|Ga0075424_100790404All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300006954|Ga0079219_10142298All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300007076|Ga0075435_100519097All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300009011|Ga0105251_10283035All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300009094|Ga0111539_10768868All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300009094|Ga0111539_12393569All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009137|Ga0066709_101329432All Organisms → cellular organisms → Bacteria → Acidobacteria1051Open in IMG/M
3300009148|Ga0105243_12849127All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium524Open in IMG/M
3300009156|Ga0111538_12994488All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300009162|Ga0075423_10276231All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300009174|Ga0105241_10816248All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300009174|Ga0105241_11892409All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009174|Ga0105241_12090192All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009177|Ga0105248_13261723All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009609|Ga0105347_1364426All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300010042|Ga0126314_10299573All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300010042|Ga0126314_10496118All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300010373|Ga0134128_12538700All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010375|Ga0105239_11556785All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300010397|Ga0134124_10646649All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300010397|Ga0134124_11307508All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300010399|Ga0134127_13497749All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010400|Ga0134122_10450451All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300010400|Ga0134122_11362350All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300011119|Ga0105246_11845209All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012046|Ga0136634_10363213All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium599Open in IMG/M
3300012198|Ga0137364_10705785All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300012201|Ga0137365_10446382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300012203|Ga0137399_11410776All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012350|Ga0137372_10946657All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium606Open in IMG/M
3300012353|Ga0137367_10755193All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012685|Ga0137397_10226564All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300012948|Ga0126375_10670449All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012961|Ga0164302_10265617All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300013100|Ga0157373_11507701All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300013296|Ga0157374_10616067All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300013296|Ga0157374_11597625All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300013297|Ga0157378_12733512All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300013306|Ga0163162_11039168All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300013307|Ga0157372_13447885All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium503Open in IMG/M
3300014154|Ga0134075_10288046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300014325|Ga0163163_10123904All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2621Open in IMG/M
3300015262|Ga0182007_10158058All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium774Open in IMG/M
3300015372|Ga0132256_102370986All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300018054|Ga0184621_10208361All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300018482|Ga0066669_10785240All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium842Open in IMG/M
3300025900|Ga0207710_10091518All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300025927|Ga0207687_10259251All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300025930|Ga0207701_10046272All Organisms → cellular organisms → Bacteria4022Open in IMG/M
3300025936|Ga0207670_10103492All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2037Open in IMG/M
3300025936|Ga0207670_10167296All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300025940|Ga0207691_11489134All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025941|Ga0207711_11859596All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300025942|Ga0207689_10018127All Organisms → cellular organisms → Bacteria5945Open in IMG/M
3300025942|Ga0207689_10059375All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium3146Open in IMG/M
3300026088|Ga0207641_10710043All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300026095|Ga0207676_12127089All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium559Open in IMG/M
3300027882|Ga0209590_10873217All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium568Open in IMG/M
3300028381|Ga0268264_10177603All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1931Open in IMG/M
3300028381|Ga0268264_10461437All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300028381|Ga0268264_11993751All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300028381|Ga0268264_12309199All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300030511|Ga0268241_10122533All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300032012|Ga0310902_10449446All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300032012|Ga0310902_10668967All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium696Open in IMG/M
3300032074|Ga0308173_11168370All Organisms → cellular organisms → Bacteria719Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere12.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.80%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.90%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0697.000035002162886007Switchgrass RhizosphereTGGRANWRGGLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ
F14TC_10877311223300000559SoilAGMFIGTANDKGVLFVPFKGQKDGRLRLRMLAVL*
JGI10214J12806_1119333923300000891SoilAKYELQMTGGRANWRGGLFNGVPGGSYIGNANGSGVMYSPFKGQKDGRLRLRLLSSE*
JGI1027J12803_10275806513300000955SoilMTGGRANWRGGLFNGVPSGTFIARANDSGVLFVPFKGEKDGRLRLRILA*
Ga0062589_10270356113300004156SoilGGRANWRGGLFNGVPGGSYIGTANGSGVMYLPFKGQKDGRLRLRLLTSE*
Ga0062595_10074160213300004479SoilRGGLFNGVPAGTFIATANESGVLYVPFEGQKDGRLRLRLLANR*
Ga0062592_10250402623300004480SoilGRANWRGGLFNGVPGGIFIGTANESGVLYVPFKGQKDGRLRVRMLAGR*
Ga0062591_10114714013300004643SoilAKYELQMTGGRANWRGGLFNGVPGGNFIGSANSSGVMYLPFQGEKDGRLRVRMLAPQ*
Ga0065712_1002583313300005290Miscanthus RhizosphereWRGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG*
Ga0065715_1010215633300005293Miscanthus RhizosphereGGRANWRGGLFNGVPAGTFIGTANGSGVLFIPFQGQKDGRLRLRILATN*
Ga0065715_1074963823300005293Miscanthus RhizosphereMTGGRANWRGGLFNGVPGGTFIARANESGVLFVPFRGEKDGRLRVRMIGN*
Ga0065705_1006966123300005294Switchgrass RhizosphereRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN*
Ga0065705_1040922213300005294Switchgrass RhizosphereGRANWRGGLFNGVPGGNFIGSANSSGVMYLPFQGEKDGRLRVRMLATQ*
Ga0070680_10096623313300005336Corn RhizosphereTGGRANWRGGLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ*
Ga0070680_10181167713300005336Corn RhizosphereRANWRGGLFNGVPGGTFTGTANESGVLYVPFKGQKDGRLRLRILASR*
Ga0070689_10021757023300005340Switchgrass RhizosphereTGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR*
Ga0070674_10150026613300005356Miscanthus RhizospherePLAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL*
Ga0070701_1106941413300005438Corn, Switchgrass And Miscanthus RhizosphereQMTGGRANWRGGLFNGVPGGTFIAKANDSGVLFAPFKGEKDGRLRLRMLANQ*
Ga0070705_10033525023300005440Corn, Switchgrass And Miscanthus RhizosphereQMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRMLAGR*
Ga0070694_10107947313300005444Corn, Switchgrass And Miscanthus RhizosphereHAKYELQMTGGRANWRGGLFNGVPGGNFIGTANGSGVLFIPFKGQKDGRLRVRLL*
Ga0070707_10195606313300005468Corn, Switchgrass And Miscanthus RhizosphereLQMTGGRANWRGGLFNGVPGGTFIAKANDSGVLFAPFKGEKDGRLRLRMLANQ*
Ga0070699_10157065313300005518Corn, Switchgrass And Miscanthus RhizosphereANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR*
Ga0070695_10150421123300005545Corn, Switchgrass And Miscanthus RhizosphereGRANWRGGLFNGVPGGTFIARANESGVLFVPFKGEKDGRLRVRTLAN*
Ga0068857_10078363423300005577Corn RhizosphereLQMTGGRANWRGGLFNGVPGGSYIATANESGVLHVPFAGQKDGRLRVRMLSR*
Ga0068857_10127978823300005577Corn RhizosphereELQMTGGRANWRGGLFNGVPGGSYIGSANGSGVIYLPFKGQKDGRLRLRLLSSE*
Ga0068856_10048440113300005614Corn RhizosphereTGGRANWRGGLFNGVPAGTFIARANDSGVLFVPFKGEKDGRLRVRMLSN*
Ga0068859_10095862513300005617Switchgrass RhizosphereLAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN*
Ga0068864_10166498523300005618Switchgrass RhizosphereFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG*
Ga0068851_1062624413300005834Corn RhizosphereGGRADWRGGLFNGVPIGTFVATANESGVLYVPFKGQQDGRLRLHLLASR*
Ga0068863_10226946613300005841Switchgrass RhizosphereANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR*
Ga0068863_10237591913300005841Switchgrass RhizosphereANWRGGLFNGVPAGIFIATANESGVLYVPFVGQKDGRLRVRMLSRN*
Ga0068860_10004466113300005843Switchgrass RhizosphereQMTGGRANWRGGLFNGVPAGTFIATANDSGVLFAPFAGEKDGRLRIHMLSAN*
Ga0068860_10008973733300005843Switchgrass RhizosphereTGGRANWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR*
Ga0068860_10077671613300005843Switchgrass RhizosphereQMTGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLATR*
Ga0068862_10107468233300005844Switchgrass RhizosphereNWRGGLYNGVPAGTFLATANDSGVLYVPFKGQKDGRLRLRLLSDR*
Ga0081540_123868213300005983Tabebuia Heterophylla RhizosphereRANWRGGLFNGVPAGTFIATANYSGVLFAPFKGEKDGRLRLRLLATN*
Ga0066656_1009584613300006034SoilWRGGLFNGVPAGSYIAAANDSGNIYLPFKGQKDGRLRIRLLSSE*
Ga0066653_1007198623300006791SoilVPGGSYIGTANSSGVMYLPFKGQKDGRLRLRLLSSE*
Ga0079221_1143675723300006804Agricultural SoilKYELQMTGGRANWRGGLFNGIPVAGYISAANSSGIIYLPFKGKKDGRLRVRLLTSE*
Ga0075421_10185949523300006845Populus RhizosphereRANWRGGLFNGVPAGTFVGTANESGVLYVPFKGQKDGRLRLRVLATR*
Ga0075433_1032445723300006852Populus RhizosphereYELQMTGGRANWRGGLFNGVPAGIFIGTANESGVLYVPFKGQKDGRLRLRLLAGR*
Ga0075433_1051775623300006852Populus RhizosphereELQMTGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRMLTA*
Ga0075433_1083659223300006852Populus RhizosphereMTGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRMLTA*
Ga0075429_10021987723300006880Populus RhizosphereRGGLFNGVPAGTFIANANSSGVLSVPFKGQKDGRLRLRML*
Ga0075429_10189690313300006880Populus RhizosphereLQMTGGRANWRGGLFNGVLAGLFVANANESGVLYVPFKGQQDGRLRLRILSR*
Ga0075424_10079040413300006904Populus RhizosphereGRANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN*
Ga0079219_1014229813300006954Agricultural SoilTGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRLLSNNRT*
Ga0075435_10051909713300007076Populus RhizosphereWRGGMFNGVPGGTFIGTANESGVLYAPFKGQKDGRLRLRILATP*
Ga0105251_1028303523300009011Switchgrass RhizosphereLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN*
Ga0111539_1076886813300009094Populus RhizosphereVPAGTLIGTANESGVLYVPFEGRKDGRLRIRVLATR*
Ga0111539_1239356923300009094Populus RhizosphereLFNGVPAGTFTGTANESGVLYVPFKGQKDGRLRVRMLATR*
Ga0066709_10132943213300009137Grasslands SoilGHFEGVPAGSYVGATNDAGNIYLPLKGEKDGRLRVRLLSS*
Ga0105243_1284912723300009148Miscanthus RhizosphereYELQMTGGRANWRGGLFNGVPAGTFIGTANESGVMYLPFKGQKDGRLRLRMLATR*
Ga0111538_1299448813300009156Populus RhizosphereLQMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFEGQKDGRLRIRVLATR*
Ga0075423_1027623113300009162Populus RhizosphereAGTFIATANESGVLYVPFKGQKDGRLRLRMLGGR*
Ga0105241_1081624823300009174Corn RhizosphereRANWRGGLFNGVPGGTFIGTANESGVLYASFKGQKDGRLRLRILATR*
Ga0105241_1189240913300009174Corn RhizosphereQMTGGRANWRGGLFNGIPGGMFIATANGSGVLYVPFAGQKDGRLRIRMLSR*
Ga0105241_1209019213300009174Corn RhizosphereNWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR*
Ga0105248_1326172323300009177Switchgrass RhizosphereGRANWRGGLFNGVPAGTFIGTANEWGVLYVPFKGQKDGRLRVRMLASR*
Ga0105347_136442623300009609SoilAKYELQMTGGRANWRGGLFNGVPGLTYVGAANGSGVMQVAWKDQKDGRLRLRML*
Ga0126314_1029957313300010042Serpentine SoilPHAKYELQMTGGRASWRGGLFNGVPAGTFIGTANESGALYVPFKGQKDGRLRLRLLATR*
Ga0126314_1049611813300010042Serpentine SoilGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRVRMLAGR*
Ga0134128_1253870013300010373Terrestrial SoilNWRGGLFNGVPAGTFTGTANESGVLYVPFKGQKDGRLRLRMLAIR*
Ga0105239_1155678523300010375Corn RhizosphereRGGLFNGVPGGTFIANANESGVLYVPFKGQKDGRLRLRMLASR*
Ga0134124_1064664923300010397Terrestrial SoilRANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN*
Ga0134124_1130750823300010397Terrestrial SoilLFNGILAGTFIGRANDSGVLYVEFKGQKDGRLRLRMLANQ*
Ga0134127_1349774913300010399Terrestrial SoilANWRGGLFNGVPAGTLIGTANESGVLYVPFEGQKDGRLRIRVLATR*
Ga0134122_1045045113300010400Terrestrial SoilGVPAVIFIGTANESGILYAPFKGQKDGRLRLRMLATR*
Ga0134122_1136235013300010400Terrestrial SoilQMTGGRANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN*
Ga0105246_1184520913300011119Miscanthus RhizosphereAKYELQMTGGRANWRGGLFNGVPAGTSIGTANESGVLYVPFKGQKDGRLRLRVLATR*
Ga0136634_1036321323300012046Polar Desert SandGGRASWRGGLFNGVPGDTYISAANGSGVMHLPFKGQKDGRLRLRLLSSD*
Ga0137364_1070578523300012198Vadose Zone SoilLFNGVPGGSYIGTDNSSGVIYLPFKGQKDGRLRLHILT*
Ga0137365_1044638213300012201Vadose Zone SoilYELQMTGGRANWRGGLFNGVPGGNYIGSANGSGIMYLPFKGQKDGRLRLRLLSTE*
Ga0137399_1141077623300012203Vadose Zone SoilAKYELQMTGGRANWRGGLFNGVPGGSYIGTANVSGVMHLPFKGQKDGRLRLRLLSSE*
Ga0137372_1094665713300012350Vadose Zone SoilKYELQMTGGRANWRGGLFNGVPGGSYIGTANGSGVIHLPFKGQKDGRLRLRILSSE*
Ga0137367_1075519313300012353Vadose Zone SoilRGGLFNGVPGGSYIGTANGSGVMHLPFKGQKDGRLRLRLLS*
Ga0137397_1022656423300012685Vadose Zone SoilLFNGVPGGSYIGAANSSGVMHAPFKGQKDGRLRLRLLSSE*
Ga0126375_1067044913300012948Tropical Forest SoilTGGRANWRGGLFNGVPGGTFIARANDSGVLFVPFKGEKDGRLRLRMLNN*
Ga0164302_1026561713300012961SoilRGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG*
Ga0157373_1150770113300013100Corn RhizosphereRANWRGGLFNGVPGANYIAAANGSGVLRVSFGGQKDGRLRLRLLATN*
Ga0157374_1061606723300013296Miscanthus RhizosphereGVPAGTFIATANDSGVLFAPFKGEKDGRLRIHMLSAN*
Ga0157374_1159762523300013296Miscanthus RhizosphereELQMTGGRANWRGGLFNGVPSGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG*
Ga0157378_1273351213300013297Miscanthus RhizosphereGRANWRGGLFNGVPGGSFIARANESGVLFVPFKGEKDGRLRLRML*
Ga0163162_1103916823300013306Switchgrass RhizosphereFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLATR*
Ga0157372_1344788513300013307Corn RhizosphereLAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL*
Ga0134075_1028804613300014154Grasslands SoilGVPAGSYIAAANGSGNMYLPFKGQKDGRLRVRLLSSE*
Ga0163163_1012390433300014325Switchgrass RhizosphereANWRGGLFNGVPGANYIAAANGSGVLRVLFGGQKDGRLRIRLLGS*
Ga0182007_1015805813300015262RhizosphereMTGGRANWRGGLFNGVPAGTFIATANESGVLYVPFKGLKDGRLRLRLLAK*
Ga0132256_10237098623300015372Arabidopsis RhizosphereNGGPGGTFTGTANESGVLYVPFKGQKDGRLRLRMLAGR*
Ga0184621_1020836123300018054Groundwater SedimentGRANWRGGLFNGVPGGSYTGAANGSGVLYLPFKGEKDGRLRVRILS
Ga0066669_1078524013300018482Grasslands SoilGGLFNGVPIGTYIGDANASGVLYLPFKGRKEGRLRVRLIT
Ga0207710_1009151823300025900Switchgrass RhizosphereGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR
Ga0207687_1025925133300025927Miscanthus RhizosphereLFNGVPGGMFIATANDSGVLYVPFEGQKDGRLRIRMLSR
Ga0207701_1004627243300025930Corn, Switchgrass And Miscanthus RhizosphereMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL
Ga0207670_1010349233300025936Switchgrass RhizosphereTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN
Ga0207670_1016729613300025936Switchgrass RhizosphereTGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR
Ga0207691_1148913423300025940Miscanthus RhizospherePAGTSIGTANESGVLYVPFKGQKDGRLRVRMLASR
Ga0207711_1185959613300025941Switchgrass RhizosphereHAKYELQMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR
Ga0207689_1001812713300025942Miscanthus RhizosphereWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRLLASR
Ga0207689_1005937513300025942Miscanthus RhizospherePYAKYELQMTGGRANWRGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG
Ga0207641_1071004313300026088Switchgrass RhizosphereVPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR
Ga0207676_1212708923300026095Switchgrass RhizosphereRGGLFNGVPSGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG
Ga0209590_1087321713300027882Vadose Zone SoilQMTGGRANWRGGLFNGVPVGSYIGAANGSGIMYLPFKGQKDGRLRLRLLSSE
Ga0268264_1017760333300028381Switchgrass RhizosphereTGGRANWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR
Ga0268264_1046143723300028381Switchgrass RhizosphereQMTGGRANWRGGLFNGVPAGTFIATANDSGVLFAPFAGEKDGRLRIHMLSAN
Ga0268264_1199375123300028381Switchgrass RhizosphereLAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL
Ga0268264_1230919923300028381Switchgrass RhizosphereYELQMTGGRANWRGGLFNGVPAGTSIGTANESGVLYVPFKGQKDGRLRVRMLASR
Ga0268241_1012253323300030511SoilGGRANWRGGLFNGVPAGTFTGTANESGVLYVPFQGQKDGRLRIRMLATR
Ga0310902_1044944623300032012SoilGLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ
Ga0310902_1066896713300032012SoilQMTGGRANWRGGLFNGVPGGSYIGTANGSGVMYLPFKGQKDGRLRLRLLTSE
Ga0308173_1116837013300032074SoilGVPAGTLIANANESGVLYVPFKGQKDGRLRLRLLAER

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.