Basic Information | |
---|---|
Family ID | F085265 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 111 |
Average Sequence Length | 41 residues |
Representative Sequence | DNALTVSVEDARVGDRFQLAVAPDRALDAFYHPFAYAA |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.90 % |
% of genes near scaffold ends (potentially truncated) | 94.59 % |
% of genes from short scaffolds (< 2000 bps) | 99.10 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.892 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.216 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.721 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.550 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 21.21% Coil/Unstructured: 62.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF03176 | MMPL | 27.93 |
PF13380 | CoA_binding_2 | 3.60 |
PF13191 | AAA_16 | 0.90 |
PF07883 | Cupin_2 | 0.90 |
PF00027 | cNMP_binding | 0.90 |
PF07730 | HisKA_3 | 0.90 |
PF02190 | LON_substr_bdg | 0.90 |
PF07690 | MFS_1 | 0.90 |
PF01343 | Peptidase_S49 | 0.90 |
PF07676 | PD40 | 0.90 |
PF02518 | HATPase_c | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 27.93 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 27.93 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.80 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.90 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.90 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.90 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.89 % |
Unclassified | root | N/A | 8.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS02F1X3M | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300000550|F24TB_11068420 | Not Available | 516 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10096010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
3300000956|JGI10216J12902_108588796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
3300001139|JGI10220J13317_10390046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
3300001686|C688J18823_11001860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 530 | Open in IMG/M |
3300003373|JGI25407J50210_10064713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 916 | Open in IMG/M |
3300003987|Ga0055471_10220889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
3300003995|Ga0055438_10099055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 821 | Open in IMG/M |
3300005093|Ga0062594_100630705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
3300005337|Ga0070682_100871975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
3300005436|Ga0070713_100327546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
3300005450|Ga0066682_10942620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300005455|Ga0070663_100790306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
3300005546|Ga0070696_101250443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300005563|Ga0068855_101826487 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300005615|Ga0070702_101144299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300005843|Ga0068860_102340376 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300006031|Ga0066651_10693182 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006034|Ga0066656_11136753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300006871|Ga0075434_101114646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 802 | Open in IMG/M |
3300006904|Ga0075424_102080803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
3300006969|Ga0075419_10753568 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009098|Ga0105245_12980313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300009177|Ga0105248_12245034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300009789|Ga0126307_11159488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300009812|Ga0105067_1079285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300010036|Ga0126305_11000082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
3300010037|Ga0126304_10193380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1329 | Open in IMG/M |
3300010041|Ga0126312_11289525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
3300010301|Ga0134070_10376772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300010325|Ga0134064_10143833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
3300010335|Ga0134063_10643796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300010337|Ga0134062_10237489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
3300010362|Ga0126377_13211732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300010366|Ga0126379_13857224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300010401|Ga0134121_11321887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
3300011439|Ga0137432_1296037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300012198|Ga0137364_11001648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
3300012201|Ga0137365_11320198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300012349|Ga0137387_10587782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
3300012350|Ga0137372_10199629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1602 | Open in IMG/M |
3300012469|Ga0150984_108179857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300012911|Ga0157301_10107586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
3300012930|Ga0137407_11379813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300012937|Ga0162653_100025998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
3300012957|Ga0164303_11369199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300012975|Ga0134110_10079188 | Not Available | 1313 | Open in IMG/M |
3300012977|Ga0134087_10430509 | Not Available | 649 | Open in IMG/M |
3300012986|Ga0164304_10705032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
3300013102|Ga0157371_10921269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
3300014157|Ga0134078_10226011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
3300015077|Ga0173483_10819768 | Not Available | 539 | Open in IMG/M |
3300016341|Ga0182035_11258953 | Not Available | 662 | Open in IMG/M |
3300017657|Ga0134074_1177027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300017947|Ga0187785_10765220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
3300017966|Ga0187776_10278405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
3300018032|Ga0187788_10545128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300018054|Ga0184621_10157761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300018064|Ga0187773_10171139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1136 | Open in IMG/M |
3300018468|Ga0066662_11616787 | Not Available | 676 | Open in IMG/M |
3300018469|Ga0190270_10002670 | All Organisms → cellular organisms → Bacteria | 8741 | Open in IMG/M |
3300018481|Ga0190271_12882922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
3300018482|Ga0066669_11881672 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300019885|Ga0193747_1032602 | Not Available | 1295 | Open in IMG/M |
3300021474|Ga0210390_11567567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300022893|Ga0247787_1038523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
3300022901|Ga0247788_1050626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
3300025313|Ga0209431_10407561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1048 | Open in IMG/M |
3300025327|Ga0209751_10680414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300025792|Ga0210143_1098373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300025795|Ga0210114_1085826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300025928|Ga0207700_10369277 | Not Available | 1252 | Open in IMG/M |
3300025941|Ga0207711_10806090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
3300025961|Ga0207712_11403578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300026312|Ga0209153_1268847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300026325|Ga0209152_10077579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
3300026523|Ga0209808_1211211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300026547|Ga0209156_10178365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1021 | Open in IMG/M |
3300027209|Ga0209875_1041678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300027511|Ga0209843_1021768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1236 | Open in IMG/M |
3300027882|Ga0209590_10743857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300028590|Ga0247823_11448643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300028713|Ga0307303_10030023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
3300028714|Ga0307309_10155788 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300028791|Ga0307290_10102908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
3300028793|Ga0307299_10101946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1073 | Open in IMG/M |
3300028809|Ga0247824_10515442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
3300028809|Ga0247824_10769606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300028812|Ga0247825_10926988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300028819|Ga0307296_10518730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300028884|Ga0307308_10536406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300030006|Ga0299907_10141416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1988 | Open in IMG/M |
3300030514|Ga0268253_10357320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 520 | Open in IMG/M |
3300030619|Ga0268386_10930399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300031152|Ga0307501_10117638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
3300031199|Ga0307495_10057087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
3300031805|Ga0318497_10489131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
3300031833|Ga0310917_11127694 | Not Available | 523 | Open in IMG/M |
3300031938|Ga0308175_100404345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1427 | Open in IMG/M |
3300032012|Ga0310902_11089277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
3300032065|Ga0318513_10259098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
3300032067|Ga0318524_10467122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
3300032075|Ga0310890_10357525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1070 | Open in IMG/M |
3300032089|Ga0318525_10176040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1099 | Open in IMG/M |
3300032174|Ga0307470_10065954 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
3300032211|Ga0310896_10862017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
3300033433|Ga0326726_11318035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300033550|Ga0247829_11029729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300033550|Ga0247829_11539147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300034644|Ga0370548_041824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.21% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.41% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.60% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.80% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.90% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.90% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_01030150 | 2170459012 | Grass Soil | PHENAVTVSVEDTRVGDRFQLTVAPDRALDAFYHPFAHAA |
F24TB_110684201 | 3300000550 | Soil | CEEAVTVSVADDRTGDRFEIAVEHRHALDAFYHPYAYAA* |
AF_2010_repII_A1DRAFT_100960102 | 3300000597 | Forest Soil | RENAVTVSVEDLHDGECFDLAIAPERALNAFYHPYAYAA* |
JGI10216J12902_1085887962 | 3300000956 | Soil | HPDENALTVSVEDDRAGDHFQLVVAPDRALDAFYHPFAYAA* |
JGI10220J13317_103900461 | 3300001139 | Soil | PAANAVTVAVEDERLGDRFQIAVAPDSALDAFYHPFAYAA* |
C688J18823_110018602 | 3300001686 | Soil | WHPREDAITVSVEDDRRGDGFQVAVAPDRALDAFYHPFAYAA* |
JGI25407J50210_100647132 | 3300003373 | Tabebuia Heterophylla Rhizosphere | RLLWHPRENGVTVSVEDSRVGDRFQLAIALDRALDAFYHPFAYAA* |
Ga0055471_102208891 | 3300003987 | Natural And Restored Wetlands | AENALTLAVEDSHLGSRFELAVAPDRALDAFYHPFAYAA* |
Ga0055438_100990552 | 3300003995 | Natural And Restored Wetlands | WHPRENAVTVEVEDSRAGECLQLVVAPKCALDAFYHPYAYAA* |
Ga0062594_1006307051 | 3300005093 | Soil | HPRENALTVEVEDARVGDSFQLAVAPERALDAFYHPYAYAA* |
Ga0070682_1008719752 | 3300005337 | Corn Rhizosphere | LLWHPRENAVTVSVEDAMVGDRFEFAIPPDQALDAFYHPFAHAA* |
Ga0070713_1003275461 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLLWHPRADAITVSVEDHRRGDSFQLAVSADRALDAFYHPFAYAA* |
Ga0066682_109426201 | 3300005450 | Soil | VLLLWHPREDELTVSVEDTRAGNRFQLAVARDRALDAFYHPFAYAA* |
Ga0070663_1007903062 | 3300005455 | Corn Rhizosphere | AVRLLWHPRENAVTVSVEDARVGDRFEFAIPPDQALDAFYHPFAHAA* |
Ga0070696_1012504432 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | WHPRDDSVSVSVADARTGDRFQLAVAREYALDAFYHPFAYAA* |
Ga0068855_1018264871 | 3300005563 | Corn Rhizosphere | DAVTVSVADDRTGDRFEIAVEHEQALDAFYHPYAYAA* |
Ga0070702_1011442992 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLWHPAENSLTVEVEDDCLGDRFQLSVAPDCALDAFYHPYAYAA* |
Ga0068860_1023403761 | 3300005843 | Switchgrass Rhizosphere | WHPRENAVTVSVEDARVGDRFEFAIPPDQALDAFYHPFAHAA* |
Ga0066651_106931822 | 3300006031 | Soil | PREDAITVSVEDERRGDRFRIAVAPNRALDAFYHPFAYAA* |
Ga0066656_111367532 | 3300006034 | Soil | ANAVIVSVEDARAGDQFDLSVAPDRALDAFYHPFAYAA* |
Ga0075434_1011146461 | 3300006871 | Populus Rhizosphere | VRLLWHPRENAVTVSVEDAMVGDRFEFAIPPDQALDAFYHPFAHA |
Ga0075424_1020808032 | 3300006904 | Populus Rhizosphere | TVSVTDSRTGDRFQLAVDRKRALDAFYHPFAYAA* |
Ga0075419_107535681 | 3300006969 | Populus Rhizosphere | PCEDAVTVLVADDRTGDRFEIAVEHEQALDAFYHPYAYAA* |
Ga0105245_129803131 | 3300009098 | Miscanthus Rhizosphere | EHALTVSVEDSRVGVGFRLPVAPDRALDAFYHPYAYAA* |
Ga0105248_122450341 | 3300009177 | Switchgrass Rhizosphere | TLTLSVKDARAGDSFQLAIAPERALDAFYHPFAYAA* |
Ga0126307_111594881 | 3300009789 | Serpentine Soil | GLNVVLFWHPRNCSVTVSVADSRTGAHFQLAVERDHALDAFYHPFAYVA* |
Ga0105067_10792851 | 3300009812 | Groundwater Sand | KAVTVSVEDALVGDRFQVAIAPDRALDAFYHPFAYAA* |
Ga0126305_110000822 | 3300010036 | Serpentine Soil | VLFWHPRNGSVTVSVADSRTGAHFQLAVERDHALDAFYHPFAYVA* |
Ga0126304_101933801 | 3300010037 | Serpentine Soil | DALTVSVEDARLGDSFHIAVARDQALDAFYNPFAYAA* |
Ga0126312_112895252 | 3300010041 | Serpentine Soil | LWHPAVNAVSVSVEDTRFDDRFEIAVAPDSALDAFYHPYAYAA* |
Ga0134070_103767722 | 3300010301 | Grasslands Soil | LWHPCEDELTVSVEDTRAGDRFQLVVARDRALDAFYHPFAYAA* |
Ga0134064_101438332 | 3300010325 | Grasslands Soil | EDAITVSVEDDRRGDRFQVAVAPNRALDAFYHPFAYAA* |
Ga0134063_106437961 | 3300010335 | Grasslands Soil | LLLWHPREDELTVSVEDTRAGNRFQLAVARDRALDAFYHPFAYAA* |
Ga0134062_102374891 | 3300010337 | Grasslands Soil | NTLTVSVEDTRAGDCFQLAIAPDSALDAFYHPFAYAA* |
Ga0126377_132117322 | 3300010362 | Tropical Forest Soil | LLSHPREDAVTVSVEDVRACHRFELAVRRDHALDAFYHPFAYAA* |
Ga0126379_138572241 | 3300010366 | Tropical Forest Soil | AVTVSVEDARVGCSFELAVARECALDAFYHPFAYAA* |
Ga0134121_113218871 | 3300010401 | Terrestrial Soil | WHPQRNAVTVSVEDNRAADRFHLAVASDRALDAFYHPFAYAA* |
Ga0137432_12960372 | 3300011439 | Soil | IHVLLLWHPIENALTVSVEDSRVGCGFQLDVAPDRALDAFYHPYAYAA* |
Ga0137364_110016481 | 3300012198 | Vadose Zone Soil | HPREDAITVSVEDDRRGDRFQLAVAPDRALDAFYHPFAYAA* |
Ga0137365_113201982 | 3300012201 | Vadose Zone Soil | LTVSVEDARDGERFHLAIAPDCALDAFYHPFAYAA* |
Ga0137387_105877822 | 3300012349 | Vadose Zone Soil | LTVSVTDSRTGDRFQLAVDRSQALDAFYHPFAYAA* |
Ga0137372_101996292 | 3300012350 | Vadose Zone Soil | VLLLWHPREDELTVSVEDRRAGNGFQLAVARDRALDAFYHPFAYAA* |
Ga0150984_1081798572 | 3300012469 | Avena Fatua Rhizosphere | MNAGTVSVEDNRAGDRFQLAVAADHALDAFYHPFAYAA* |
Ga0157301_101075861 | 3300012911 | Soil | ENALTVEVEDARIGDGFQLAVAPGRALDAFYHPFAYAA* |
Ga0137407_113798132 | 3300012930 | Vadose Zone Soil | VHVLLFWHPHEDALTVSVEDARAGQRFEFSVDRSRGLDAFYHPYAYAA* |
Ga0162653_1000259982 | 3300012937 | Soil | SVSVSVADARTGDRFQLAVAREYALDAFYHPFAYAA* |
Ga0164303_113691992 | 3300012957 | Soil | HPREDAITVSVEDDLRGDRFRIAVAPNRALDASYHPFAYAA* |
Ga0134110_100791881 | 3300012975 | Grasslands Soil | REDAITVSVEDDRRGDRFRIAVAPNRALDAFYQPFAYAA* |
Ga0134087_104305092 | 3300012977 | Grasslands Soil | VAPRDDALTVSVEDLRVGDRFELVVERSCALDAFYHPYAYAA* |
Ga0164304_107050322 | 3300012986 | Soil | WHPRENALTVSVEDARVGDRFQLAVAPDRAFDAFYHPFAYAA* |
Ga0157371_109212692 | 3300013102 | Corn Rhizosphere | VLLWHPREDAVTVSVEDLRADRRFELAVERERALDAYYHPFAYAA* |
Ga0134078_102260112 | 3300014157 | Grasslands Soil | AVTVAVEDAHGGECFHLPIAADRALDAFYHPFAYAA* |
Ga0173483_108197682 | 3300015077 | Soil | REDAVTVSVADDRTGDRFEIDVERRHALDAFYHPYAYAA* |
Ga0182035_112589531 | 3300016341 | Soil | SNGISVRLLWHSRENAVTVSVEDLHDGECFDLAIAPERALDAFYHPYAYAA |
Ga0134074_11770272 | 3300017657 | Grasslands Soil | LLLWHPREDELTVSVEDTRAGNRFQLAVARDRALDAFYHPFAYAA |
Ga0187785_107652201 | 3300017947 | Tropical Peatland | ENAVTVSVEDGHDGRYFDLAVAPQHALDAFYHPFAYAA |
Ga0187776_102784051 | 3300017966 | Tropical Peatland | GNDALTVSVEDIRAGERLQLAVAPESALDAFNHPYAYAA |
Ga0187788_105451282 | 3300018032 | Tropical Peatland | LLWHPREDAVTVSVEGARAEHRFELAVGREHALDAFYHPFAHTA |
Ga0184621_101577611 | 3300018054 | Groundwater Sediment | DAITVSVEDDRRGDRFRIAVAPNRVLDAFYHPFAYAA |
Ga0187773_101711391 | 3300018064 | Tropical Peatland | PSNHAVTLAIADSRTGARFELVVDRERALDAFYHPFAYAA |
Ga0066662_116167872 | 3300018468 | Grasslands Soil | LLWHPGENAVTVSVDDARVGDRFQLSITPDRALDAFYHPFAYRHGA |
Ga0190270_100026706 | 3300018469 | Soil | LLWHPDENELTVSVEDGRAGDRFQLVVAPDRTLDAFYHPFAYPA |
Ga0190271_128829222 | 3300018481 | Soil | WHPGDNALTVSVEDTRAGRGFRLAVAPDRALDAFYHPYAYAA |
Ga0066669_118816721 | 3300018482 | Grasslands Soil | LWHPRDDALTVSVEDDRRGDRFQFAVPADQALDAYYHPFAYAA |
Ga0193747_10326021 | 3300019885 | Soil | ITVSVEDDRRGDRFRIAVAPNRVLDAFYHPFAYAA |
Ga0210390_115675672 | 3300021474 | Soil | DGVTVVLLWHPREDAVTLAVSDSRTGDQFELVVASDRALEAFYHPFAPNA |
Ga0247787_10385232 | 3300022893 | Soil | DAVTVSVEDARAGDSFQLRVASDRALDAFYHPFAYAA |
Ga0247788_10506261 | 3300022901 | Soil | DDALTVSVEDARLGDRFRIAVAPERALDAFYHPFAYAA |
Ga0209431_104075612 | 3300025313 | Soil | VLLWHPYENTLTVSVEDARVADRFQLAVAPDRALDAFYHPFAYAA |
Ga0209751_106804141 | 3300025327 | Soil | NENALTVSVEDARVGDGFQLAVAPDRALDAFYHPFAYAA |
Ga0210143_10983732 | 3300025792 | Natural And Restored Wetlands | VGNALTVSVEDTRAGRGFRLAVAPDRALDAFNHPYAYAA |
Ga0210114_10858262 | 3300025795 | Natural And Restored Wetlands | NALTVAVEDERAGHRFHLTVAPDRALDTFYHPFAYAA |
Ga0207700_103692771 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YVLLLWHPRADAITVSVEDHRRGDSFQLAVSADRALDAFYHPFAYAA |
Ga0207711_108060901 | 3300025941 | Switchgrass Rhizosphere | VRLLWHPRENAVTVSVEDAMVGDRFEFAIPPDQALDAFYHPFAHAA |
Ga0207712_114035782 | 3300025961 | Switchgrass Rhizosphere | HPRDDSVSVSVSDARTGDRFQLAVAREYALDAFYHPFAYAA |
Ga0209153_12688472 | 3300026312 | Soil | LTVAVEDARAGDRFHLAVAPDRALDAFYHPFAYAA |
Ga0209152_100775793 | 3300026325 | Soil | LWHPRRNAVTVSVEDTRAGGRFQLAVAAERALDAFYHPFAYAA |
Ga0209808_12112112 | 3300026523 | Soil | HPLENGLTVAVEDARDGDRFQLAVAPERALDAFYHPFAYAA |
Ga0209156_101783652 | 3300026547 | Soil | RKNALSLSVEDTRVGDRFHLAVARDRALDAFYHPFAYAA |
Ga0209875_10416782 | 3300027209 | Groundwater Sand | DNALTVSVEDARVGDRFQLAVAPDRALDAFYHPFAYAA |
Ga0209843_10217682 | 3300027511 | Groundwater Sand | DENTLTVSVEDARVGDCFRLAVAPDRALDAFYHPFAYAA |
Ga0209590_107438571 | 3300027882 | Vadose Zone Soil | GVRGLLLWHPREDALTVSVEDARAGQRFEFSVDRSRGLDAFYHPYAYAA |
Ga0247823_114486431 | 3300028590 | Soil | PDENALTVSVDDVRAGDHFQVAVPPDRALDAFYHPFAYAA |
Ga0307303_100300232 | 3300028713 | Soil | MNATAVTVSVTDSRTGDRFQVAVDRRCALDAFYHPFAYAA |
Ga0307309_101557881 | 3300028714 | Soil | ITVSVEDDRRGDRFQVAVAPDRALDAFYHPFAYAA |
Ga0307290_101029082 | 3300028791 | Soil | KDAVTVSVDDAKTGDRFEIAVDRARALDAFYHPYAYAA |
Ga0307299_101019462 | 3300028793 | Soil | CKDAVTVSVDDAKTGDRFEIAVDRTRALDAFYHPYAYAA |
Ga0247824_105154421 | 3300028809 | Soil | TLLWHPNENALIVSVEDAHAGRGFQLAVAPDRALDAFYHPYAYAA |
Ga0247824_107696061 | 3300028809 | Soil | IQVTLLWHPGDNALTVSVEDNRAGRGFRLAVAPDRALDAFYHPYAYAA |
Ga0247825_109269882 | 3300028812 | Soil | AANAVSVAVEDERLGDRFQIAVAPDSALDAFYHPFAYAA |
Ga0307296_105187302 | 3300028819 | Soil | ITVSVEDARADDCFQLAVSPERALDAFHHPFAYAA |
Ga0307308_105364062 | 3300028884 | Soil | PGEDAVTVSVTDSRTGDRFQLAVDRKQALDAFYHPFAYAA |
Ga0299907_101414162 | 3300030006 | Soil | LAENALTVCVEDRRDGDHVQLAVASDRALGAFYHPFAYAA |
Ga0268253_103573202 | 3300030514 | Agave | PGEDAVTVVVEDLRTGVRIEMAVDRRDALAAFHHPFAYAP |
Ga0268386_109303991 | 3300030619 | Soil | WHADVNAVTVSVEDVRVGDRFQIAVAPDRALDAFYHPFAYAA |
Ga0307501_101176381 | 3300031152 | Soil | RENTLTVSVEDARVGDQFDIAVAPDRALDAFYHPFAYAA |
Ga0307495_100570871 | 3300031199 | Soil | EHAITVSVEDDRRGDRFQVAVAPDRALDAFYHPFAYAA |
Ga0318497_104891312 | 3300031805 | Soil | VTVSVDDSRAGSHFELAVARDRALQAFYHPFAYAA |
Ga0310917_111276942 | 3300031833 | Soil | NAVTVSVEDLHDGEYFDLAIAPEHALDAFYHPYAYAA |
Ga0308175_1004043453 | 3300031938 | Soil | SLFWHQDDDSVTVSVADGCTGERFQLVVARESVVDAFYHPFAYAA |
Ga0310902_110892771 | 3300032012 | Soil | HPGDDAVTVSVEDARAGDSFQLRVASDRALDAFYHPFAYAA |
Ga0318513_102590981 | 3300032065 | Soil | HPLKSVLTVSVEDTRIGDRFQLAVAPERALDAFYHPFAYAA |
Ga0318524_104671222 | 3300032067 | Soil | DAVTVSVEDPRTEHRFELVVERERALDAFYHPFAYAA |
Ga0310890_103575252 | 3300032075 | Soil | HPAANAVSVAVEDERLGDRFQIAVAPDSALDAFYHPFAYAA |
Ga0318525_101760401 | 3300032089 | Soil | LKSVLTVSVEDTRIGDRFQLAVAPERALDAFYHPFAYAA |
Ga0307470_100659541 | 3300032174 | Hardwood Forest Soil | AVTVSVADDRTGDRFEIAVEHEQALDAFYHPYAYAA |
Ga0310896_108620171 | 3300032211 | Soil | WHPAANAVTVAVEDERLGDRFQIAVAPDSALDAFYHPFAYAA |
Ga0326726_113180352 | 3300033433 | Peat Soil | SNAVTVSIEDARVGDCFEFAIPPDQALDAFYHPFAHAA |
Ga0247829_110297291 | 3300033550 | Soil | VSVSVADARTGDRFQLAVAREYALDAFYHPFAYAA |
Ga0247829_115391472 | 3300033550 | Soil | ALTVSVEDAHAGRGFQLAVAPDRALDAFYHPYAYAA |
Ga0370548_041824_2_115 | 3300034644 | Soil | DALTVSVEDDRLGDRFQLAVAPDRALDAFYHPFAYAA |
⦗Top⦘ |