NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084973

Metagenome Family F084973

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084973
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 122 residues
Representative Sequence RRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Number of Associated Samples 79
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.59 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.297 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(67.568 % of family members)
Environment Ontology (ENVO) Unclassified
(88.288 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(67.568 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.67%    β-sheet: 0.00%    Coil/Unstructured: 95.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF07690MFS_1 72.97
PF01053Cys_Met_Meta_PP 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.90
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.90
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.90
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.90
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.90
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.90
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.90
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.90
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.90
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.30 %
UnclassifiedrootN/A2.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10125590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300004091|Ga0062387_100404598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300010048|Ga0126373_12379990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300010358|Ga0126370_11237921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300010366|Ga0126379_12437165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300010398|Ga0126383_13020240Not Available549Open in IMG/M
3300012971|Ga0126369_10211965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881877Open in IMG/M
3300016270|Ga0182036_10078764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882174Open in IMG/M
3300016270|Ga0182036_10139178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1713Open in IMG/M
3300016270|Ga0182036_10823278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300016319|Ga0182033_10349663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1236Open in IMG/M
3300016341|Ga0182035_12168108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300016357|Ga0182032_10589113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium924Open in IMG/M
3300016357|Ga0182032_11210350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300016387|Ga0182040_10777295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300016404|Ga0182037_10434373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1089Open in IMG/M
3300016404|Ga0182037_11173224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300016422|Ga0182039_11483638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300016445|Ga0182038_10213420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1528Open in IMG/M
3300020579|Ga0210407_11133436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300021178|Ga0210408_10363241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1154Open in IMG/M
3300021444|Ga0213878_10132908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1026Open in IMG/M
3300027812|Ga0209656_10243239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium854Open in IMG/M
3300031474|Ga0170818_106499403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300031543|Ga0318516_10508300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300031545|Ga0318541_10733626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300031545|Ga0318541_10753603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300031546|Ga0318538_10748134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300031549|Ga0318571_10316947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300031572|Ga0318515_10611043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300031572|Ga0318515_10737663Not Available520Open in IMG/M
3300031573|Ga0310915_10759342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300031680|Ga0318574_10503501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium710Open in IMG/M
3300031681|Ga0318572_10333641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium898Open in IMG/M
3300031682|Ga0318560_10160750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1191Open in IMG/M
3300031682|Ga0318560_10270965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium913Open in IMG/M
3300031682|Ga0318560_10350674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium797Open in IMG/M
3300031682|Ga0318560_10677731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300031713|Ga0318496_10689312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300031719|Ga0306917_10071957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2401Open in IMG/M
3300031723|Ga0318493_10417540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300031736|Ga0318501_10012442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3342Open in IMG/M
3300031736|Ga0318501_10022211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882690Open in IMG/M
3300031736|Ga0318501_10078988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1605Open in IMG/M
3300031744|Ga0306918_10310785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1216Open in IMG/M
3300031747|Ga0318502_10389840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300031763|Ga0318537_10016364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882550Open in IMG/M
3300031763|Ga0318537_10116859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300031764|Ga0318535_10278731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300031769|Ga0318526_10136526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium994Open in IMG/M
3300031770|Ga0318521_11038599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031771|Ga0318546_10841108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300031771|Ga0318546_11146998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300031771|Ga0318546_11274850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300031780|Ga0318508_1165142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031782|Ga0318552_10332393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium773Open in IMG/M
3300031792|Ga0318529_10063901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1612Open in IMG/M
3300031793|Ga0318548_10196307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300031793|Ga0318548_10238185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium894Open in IMG/M
3300031793|Ga0318548_10456585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300031796|Ga0318576_10172811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1012Open in IMG/M
3300031796|Ga0318576_10348748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031797|Ga0318550_10366558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031805|Ga0318497_10649162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium592Open in IMG/M
3300031831|Ga0318564_10162004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300031832|Ga0318499_10176478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium833Open in IMG/M
3300031833|Ga0310917_10999908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300031835|Ga0318517_10152871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1032Open in IMG/M
3300031846|Ga0318512_10402880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium688Open in IMG/M
3300031879|Ga0306919_10051634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882723Open in IMG/M
3300031879|Ga0306919_10181728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1553Open in IMG/M
3300031879|Ga0306919_10905519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300031890|Ga0306925_10530078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1251Open in IMG/M
3300031893|Ga0318536_10245912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium909Open in IMG/M
3300031896|Ga0318551_10532231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300031896|Ga0318551_10538202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300031910|Ga0306923_12349419Not Available530Open in IMG/M
3300031912|Ga0306921_10312545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1839Open in IMG/M
3300031912|Ga0306921_11873881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031942|Ga0310916_10211359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1626Open in IMG/M
3300031954|Ga0306926_10427971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1632Open in IMG/M
3300031954|Ga0306926_12606767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300031981|Ga0318531_10139282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1083Open in IMG/M
3300031981|Ga0318531_10457546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300031981|Ga0318531_10521412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300032010|Ga0318569_10131179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1146Open in IMG/M
3300032025|Ga0318507_10053524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1593Open in IMG/M
3300032025|Ga0318507_10132429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1058Open in IMG/M
3300032025|Ga0318507_10387201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300032035|Ga0310911_10165720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1248Open in IMG/M
3300032035|Ga0310911_10550774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300032035|Ga0310911_10770699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300032041|Ga0318549_10215056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium864Open in IMG/M
3300032042|Ga0318545_10155659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium813Open in IMG/M
3300032043|Ga0318556_10089560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1546Open in IMG/M
3300032052|Ga0318506_10092811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1282Open in IMG/M
3300032055|Ga0318575_10226313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium942Open in IMG/M
3300032055|Ga0318575_10599206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300032063|Ga0318504_10296590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300032063|Ga0318504_10569944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300032064|Ga0318510_10074217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1253Open in IMG/M
3300032066|Ga0318514_10299658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium850Open in IMG/M
3300032066|Ga0318514_10460722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300032068|Ga0318553_10612862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300032076|Ga0306924_10571713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1281Open in IMG/M
3300032091|Ga0318577_10576951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300032205|Ga0307472_102033134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300032261|Ga0306920_103262309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300033289|Ga0310914_10385582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1268Open in IMG/M
3300033290|Ga0318519_10868522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300033290|Ga0318519_10955791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil67.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.50%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.70%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1012559013300003218Bog Forest SoilFPIADTKRMHGRQLADQGALVSELPRRDDEDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLARRPVRVTRYPQPFYRTEGLCDPERSSSRYELPALEAGLFGKHSQMRIDHA*
Ga0062387_10040459813300004091Bog Forest SoilRVTGDGGLVSELPRRDDENGERAAGALIRRLEIQWPKGARRLTVLLLPDCDVEDQVLPVTPLDHWLARRPVRLPRVPQPLYRTRGLCDPEQKPLVELPALGAGPLGKYSQMRIDHA*
Ga0126373_1237999013300010048Tropical Forest SoilPISGDGALVSELPRRDDEQGKRAAGALIRRLEVVWPKGARRLTVSLLPDCDVEDQVLPVAPLDCWLARRPVRLHRYPQPLYRTEDLRAAKRNAPDRMPAVEAGLFANHH*
Ga0126370_1123792113300010358Tropical Forest SoilILEPANARFELTFPPPSCSFPVADIRQLHGRPISGDGALVSELPRRDDEQGKRAAGALIRRLEVVWPKGARRLTVSLLPDCDVEDQVLPVAPLDYWLDRRPARLHRYPQPLYRTEDLRAAKRNAPDRLPAVEAGLFANHH*
Ga0126379_1243716513300010366Tropical Forest SoilATHDGGLVTELPRRDDENGERAAGALIRRLEIRWPKGARRLTVLLLPDCDVEDQVLPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA*
Ga0126383_1302024023300010398Tropical Forest SoilLPRRDDEDGKRAAGALIKRLEVRWPRGAPRLTVLLLPDCDVDDQALPVAPLNHWLTRHPIHRSRRPQPVYRTKGLCDPEQSVLYELPVLDTGSSGNYSRMRINHA*
Ga0126369_1021196533300012971Tropical Forest SoilDTRRLHGRRPNGSLVSELPRRDDENGERAAGAPIRRLEIQWPKGAHRLTVLLLPDCDVEDQLLPVTPLDHWLARRPVRLPRFPQPLYRTEGLCDPEQSSLAELPALEAGPLGKYSQMRIDHA*
Ga0182036_1007876413300016270SoilRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0182036_1013917823300016270SoilFPPPPCSFPVADIRQLHGRPISGNGALVSELPRRDDEQGKRAAGALIRRLEVAWPKGARRLTVSLLPDCDVEDQVLPVAPLDYWLARRPVRLHRYPQPLYRTEDLRAAKRNAPDRLPAVEAGLFANHH
Ga0182036_1082327813300016270SoilTARFELTLPPAPFSFPIADTKQLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVTRYPQAFYRTEGLRVPSGPPPRNKLPALEAGPFGKHSQKKERLCLSS
Ga0182033_1034966313300016319SoilLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0182035_1216810813300016341SoilPLADDFCRVSLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0182032_1058911313300016357SoilRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0182032_1121035023300016357SoilLPPAPCSFPIADARPLHGRRSTGEGALVSELPRRDDRDGKRAVGAMIRRLEVRWPRGARRLAVSLLPDCNTEDPVLPVTSLDHWLARRPVGLARYPQPFYRAESFRDLERSSPDQLPARAGGHFAKHSRMRMDHV
Ga0182040_1077729523300016387SoilPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0182037_1043437313300016404SoilPAPCSFAIGDARPLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMNRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0182037_1117322413300016404SoilLTFPPAPCSFPVADTRRLHGRRPNGSLVSELPRRDDENGERAAGAPIRRLEIQWPKGAHRLTVLLLPDCDVEDQVLPVTPLDHWLARRPVRLPRFPQPLYRTEGLCDPEQSSLAELPALEAGPLGKYSQMRIDHA
Ga0182039_1148363813300016422SoilRLTVLLLPDCDAEDQALPVTPLDHWLAQRPVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0182038_1021342013300016445SoilPPCSFPVADIRQLHGRPISGDGALVSELPRRDDEQGKRAAGALIRRLEVAWPKGARRLTVSLLPDCDVEDQVLPVAPLDYWLARRPVRLHRYPQPLYRTEDLRAAKRNAPDRFPAVEAGLFANHH
Ga0210407_1113343623300020579SoilTRRLHGRRPTGDGGLVSELPRRDDEEGERAAGALIKRLEIQWPKGARRLTVLLLPDCDVGDQECPVSPLDHWLARRPVRLRRFPQPLYRTEGLCDPERSPLAELPALQAGPLGKHSQMRIDHA
Ga0210408_1036324113300021178SoilPAPCSFPVADTRRLHGHPVTGDRALVSELPRRDDEDGKRAAGALIKRLEVRWPRGERRLTVLLLPDCDVEDQILPVTSLDHWLIRHPIRFSRLPQPLYQTKGLCDPDQSPLDELPALEAGPFGKYSRMRIDHA
Ga0213878_1013290813300021444Bulk SoilRRLHGRPFVGEGILVSELPRCDDQDGKRAAGALIRRLEVSWPRGARRLTVLLLPDCDAEDQALSVTSLDHWLAQRPVRFARFPQPFYRTEGLCDPEQRSSDKLPAPEAGLFGKHSRIRIDHA
Ga0209656_1024323913300027812Bog Forest SoilDLTLPPAPCSFPIADIKRLHGRQVAGDGAVISELPRRDDQDGRRAAGALIRRLEVPWPRGVRRLTVLLLPDCNAEDPALPVITPLDHWLARRPARFARYPRPFYRTERLRGPERSSPGELPAVEARRFEEYSRTRTDHA
Ga0170818_10649940323300031474Forest SoilLPRRDDEQGKRAAGALIKRLEVAWPKGARRLTISLLPDCDVEDQVLPVAPLDYWLARRPVRLHRYPQPLYRTEDLRAAKRSRPDRLPAVEAALFANHSLRRIDHA
Ga0318516_1050830013300031543SoilAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318541_1073362613300031545SoilPSADTKRLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPKGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVWVTCYPQPFYRGSPRPEWNSSPYKLPALEAGPFGKHSQNEERSCLSF
Ga0318541_1075360323300031545SoilEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318538_1074813423300031546SoilADARPLHGRRSTGEGALVSELPRRDDRDGKRAVGAMIRRLEVRWPRGARRLAVSLLPDCNTEDPVLPVTSLDHWLARRPVGLARYPQPFYRAESFRDLERSSPDQLPARAGGHFAKHSRMRMDHV
Ga0318571_1031694723300031549SoilLVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318515_1061104313300031572SoilLIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318515_1073766313300031572SoilSFPITDIKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSLIRIDHA
Ga0310915_1075934223300031573SoilGDARPLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLSDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0318574_1050350113300031680SoilLPPAPCSFAIGDARPLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0318572_1033364123300031681SoilAPCSFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318560_1016075013300031682SoilRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318560_1027096513300031682SoilQLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVWVTCYPQPFYRGSPRPEWNSSPYKLPALEAGPFGKHSQNEERSCLSF
Ga0318560_1035067413300031682SoilPIISCPLADDFCRVSLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0318560_1067773113300031682SoilADSRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0318496_1068931223300031713SoilRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0306917_1007195733300031719SoilTGEGALVSELPRRDDRDGKRAVGAMIRRLEVRWPRGARRLAVSLLPDCNTEDPVLPVTSLDHWLARRPVGLARYPQPFYRAESFRDLERSSPDQLPARAGGHFAKHSRMRMDHV
Ga0318493_1041754023300031723SoilLEPSTARFELALPPAPCSFPITDIKGLHGRTLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318501_1001244243300031736SoilPPAPCSFPIADSRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318501_1002221113300031736SoilIKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318501_1007898813300031736SoilGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0306918_1031078513300031744SoilGRPLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0318502_1038984013300031747SoilEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0318537_1001636413300031763SoilKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318537_1011685923300031763SoilFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318535_1027873123300031764SoilLTFPPAPCSFPVADTRGLHGRPLTSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDHWLARRPVQLVRYPQPVYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0318526_1013652613300031769SoilEPSTARFELALPPAPCSFPITDIKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318521_1103859913300031770SoilCFEMTLPPAPCSFAIGDARPLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0318546_1084110823300031771SoilRPVAGESILVSELPRRDDHDGKRAAGALIRRLEVPWPKGARRLSVLLLPDCDVEDPVLPVTSLDHWLARRPVPRGRYPQPLYRTEGLCDPERSLADILPEREAGFFGKISPMRIDHA
Ga0318546_1114699813300031771SoilRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318546_1127485023300031771SoilLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318508_116514213300031780SoilHGRPLTSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDDWLARRPVQLVRYPQPIYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0318552_1033239313300031782SoilLHGRPLADQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318529_1006390113300031792SoilFELTMPPAPCSFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318548_1019630713300031793SoilFELTLPPAPFSFPIADTKQLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVTRYPQAFYRTEGLRVPSGPPPRNKLPALEAGPFGKHSQKKERLCLSS
Ga0318548_1023818523300031793SoilARRLHGRPLTDEGAVVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0318548_1045658513300031793SoilALPPAPCSFPITDIKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318576_1017281123300031796SoilLVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318576_1034874823300031796SoilLEPDTARFELTLPPAPFSFPIADTKQLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVTRYPQAFYRTEGLRVPSGPPPRNKLPALEAGPFGKHSQKKERLCLSS
Ga0318550_1036655823300031797SoilHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPKGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVWVTCYPQPFYRGSPRPEWNSSPYKLPALEAGPFGKHSQNEERSCLSF
Ga0318497_1064916223300031805SoilAPRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318564_1016200413300031831SoilQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318499_1017647823300031832SoilGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0310917_1099990813300031833SoilSFPSADTKRLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPKGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVSCYPQFFYRTEGLRDPEWNSSPCKLSALGAGPFGKHSQNEDRSCLSS
Ga0318517_1015287113300031835SoilILEPNAAHFELTMPPAPCSFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318512_1040288023300031846SoilAPCSFAIGDARPLHGHRSTGEGTLVSELPRRDDRDGKRAVGVMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0306919_1005163413300031879SoilGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0306919_1018172823300031879SoilRLQGRPLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0306919_1090551923300031879SoilDTKRLHGHQLADQGALVSELPRRDDERGKRAAGALIRRLEARWPKGARRLTVLLLPDCDTEDQALPVIPLDHWLAGRPVRVSCCPQPFYRTEGLRDPEWNSSPCKLSALGAGPFGKHSQNEDRSCLSS
Ga0306925_1053007813300031890SoilGESILVSELPRRDDHDGKRAAGALIRRLEVPWPKGARRLSVLLLPDCDVEDPVLPVTSLDHWLARRPVPRGRYPQPLYRTEGLCDPERSLADILPEREAGFFGKISPMRIDHA
Ga0318536_1024591213300031893SoilRPLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0318551_1053223113300031896SoilPVADTRGLHGRPLTSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDHWLARRPVQLVRYPQPVYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0318551_1053820223300031896SoilVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0306923_1234941913300031910SoilRRLHGRRPNGDGSLVSELPRRDDENGERAAGAPIRRLEIQWPKGAHRLTVLLLPDCDVEDQVPSVTPLDHWLARRPVRLPHFSQPLYRTEGLCDPEQSSLAELPALKAGPLGKYSQMRIDHA
Ga0306921_1031254533300031912SoilTARFELTLPPAPCSFPIADARRLHGRPLTDEGAVVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0306921_1187388113300031912SoilPVADTRGLHGRPLTSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDHWLARRPVQLVRYPQPIYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0310916_1021135923300031942SoilSRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0306926_1042797123300031954SoilIADARRLHGRPLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0306926_1260676713300031954SoilRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318531_1013928223300031981SoilGRSSIDPGTLVSELPRRDDQDGERATGALIRRLEVLWPRGARRLTVLLLPDCDTEEPVVPVSSLDHWLARRPVRRARHPQPLYRTDGLCGPARSPPHKLPAREAGAFGKHSQMRIDHG
Ga0318531_1045754613300031981SoilAPCSFPIADSRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGAQRLTVLLLPDCDAEDQTLPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0318531_1052141213300031981SoilRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318569_1013117923300032010SoilRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318507_1005352423300032025SoilLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318507_1013242923300032025SoilVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318507_1038720113300032025SoilEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0310911_1016572023300032035SoilPPAPCSFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0310911_1055077423300032035SoilAPCSFPIADARPLHGRRSTGEGALVSELPRRDDRDGKRAVGAMIRRLEVRWPRGARRLAVSLLPDCNTEDPVLPVTSLDHWLARRPVGLARYPQPFYRAESFRDLERSSPDQLPARAGGHFAKHSRMRMDHV
Ga0310911_1077069923300032035SoilTACFALTLPPAPCSFPIADTKRLHGHQLADQGALVSELPRRDDERGKRAAGALIRRLEARWPKGARRLTVLLLPDCDTEDQALPVIPLDHWLAGRPVRVSCCPQPFYRTEGLRDPEWNSSPCKLSALGAGPFGKHSQNEDRSCLSS
Ga0318549_1021505623300032041SoilLHGHRSTGEGTLVSELPRRDDRDGKRAVGAMIRRLEVRWPKGARRLAVLLLPDCDTEDPVLPVTSLDHWLARHKVGSARYPQPSYRTEGSHDFERSSPAQLPARARSHFGKHSRMRIDHV
Ga0318545_1015565913300032042SoilPLTSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDDWLARRPVQLVRYPQPVYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0318556_1008956023300032043SoilFPITDIKGLHGRPLAGQGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDYDAENQAVPVAPLDDWLAPRPVGSPRYPEPFYRTEGLRDHERSSTYELPALEAGLFGKHSRIRIDHA
Ga0318506_1009281123300032052SoilRLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPKGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVWVTCYPQPFYRGSPRPEWNSSPYKLPALEAGPFGKHSQNEERSCLSF
Ga0318575_1022631323300032055SoilELTLPPAPCSFPIADSRRLHGRPFAGEGALVSELPRRDDQDGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDAEDQALPVTPLDHWLARRSIRVARYPQPFYRTEGLCDPARSSPDALPALEAGLVGKYSRMRIDHA
Ga0318575_1059920613300032055SoilAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGAPRLTVLLLPDCGAEDQELPVTPLDRWLAQRPVRPARYRQPFYRTKGLCDPERSSSDVLPALEAVRFAKLTNEERSCPSF
Ga0318504_1029659013300032063SoilSEGALVSELPRNDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDYDTEDQVLSVASLDHWLARRPVQLVRYPQPVYRTKGLCDPERSPPNELPAPEAGFFGKHLRMRIDHV
Ga0318504_1056994413300032063SoilPAPCSFPIADTKRLHGHQLADQGALVSELPRRDDERGKRAAGALIRRLEARWPKGARRLTVLLLPDCDTEDQALPVIPLDHWLAGRPVRVSCCPQPFYRTEGLRDPEWNSSPCKLSALGAGPFGKHSQNEDRSCLSS
Ga0318510_1007421723300032064SoilELTLPPAPFSFPIADTKQLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVTRYPQAFYRTEGLRVPSGPPPRNKLPALEAGPFGKHSQKKERLCLSS
Ga0318514_1029965813300032066SoilADTKRLHGHQLADQGALVSELPRRDDERGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVRVTRYPQAFYRTEGLRVPSGPPPRNKLPALEAGPFGKHSQKKERLCLSS
Ga0318514_1046072213300032066SoilDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318553_1061286213300032068SoilRPSSAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0306924_1057171313300032076SoilILEPNAAHFELTMPPAPCSFPIADTRRLHGRPSAAEGALVSELPRRDDQDGKRAAGALIRRLEIRWPRGARRLTVLLLPDCGAEDQELPVTPLDHWLAQRQVRPARYRQPFYRTEGLCDPERSPSDVLPPLEAVRFAKLTNEERSCPSF
Ga0318577_1057695123300032091SoilADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPRGARRLTVLLLPDCDTEDQALPVIPLDHWLAGRPVRVSCCPQPFYRTEGLRDPEWNSSPCKLSALGAGPFGKHSQNEDRSCLSS
Ga0307472_10203313423300032205Hardwood Forest SoilEGALVSELPRRDDEDGKRAAGALIRRLEISWPKGARRLTVLLLPDCDTEDQVLPVASLDHWLARRPVQLVRYPQPLYRTKGLCDPERSPPNTLPAREAGFFGKHLQMRIDHV
Ga0306920_10326230913300032261SoilTFPPPSCSFPVADIRQLHGRPISGDGALVSELPRRDDEQGKRAAGALIRRLEVAWPKGARRLTVSLLPDCDVEDQVLPVAPLDYWLARRPIRLHRYPQPLYRTEDLRAAKRNAPDRLPAVEAGLFANHH
Ga0310914_1038558213300033289SoilDFCRVSLTDEGAAVSELPRRDDQDGKRAAGAMIRRLEIRWPRGTRCLSVLLLPDCDTEDPVLPVTSLDHWLARRPIRFARYHPKPLYRTEGLCARSSPDELPAREAGFFGKHSLVRINHA
Ga0318519_1086852213300033290SoilTKRLHGHQFADQGALVSELPRRDDEHGKRAAGALIRRLEVPWPKGARRLTVLLLPDCDTEDQALPVTPLDHWLAGRPVWVTCYPQPFYRGSPRPEWNSSPYKLPALEAGPFGKHSQNEERSCLSF
Ga0318519_1095579113300033290SoilNGSLVSELPRRDDENGERAAGAPIRRLEIQWPKGAHRLTVLLLPDCDVEDQVLPVTPLDHWLARRPVRLPRFLQPLYRTEGLCDPEQSSLAELPALEAGPLGKYSQMRIDHA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.