NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084860

Metagenome / Metatranscriptome Family F084860

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084860
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 39 residues
Representative Sequence MPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR
Number of Associated Samples 84
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.61 %
% of genes near scaffold ends (potentially truncated) 19.64 %
% of genes from short scaffolds (< 2000 bps) 83.04 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.107 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.536 % of family members)
Environment Ontology (ENVO) Unclassified
(53.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.750 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF13620CarboxypepD_reg 4.46
PF02738MoCoBD_1 4.46
PF00270DEAD 2.68
PF11874DUF3394 0.89
PF03965Penicillinase_R 0.89
PF13432TPR_16 0.89
PF00271Helicase_C 0.89
PF02897Peptidase_S9_N 0.89
PF02653BPD_transp_2 0.89
PF00903Glyoxalase 0.89
PF00753Lactamase_B 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.89
COG1770Protease IIAmino acid transport and metabolism [E] 0.89
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.89
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.11 %
UnclassifiedrootN/A0.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_14002602All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300000956|JGI10216J12902_107884958All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300001431|F14TB_102572534All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300004643|Ga0062591_101134975All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300005328|Ga0070676_11264826All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300005331|Ga0070670_101633252All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300005353|Ga0070669_100058200All Organisms → cellular organisms → Bacteria2836Open in IMG/M
3300005365|Ga0070688_100469709All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300005367|Ga0070667_101866179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300005543|Ga0070672_100032164All Organisms → cellular organisms → Bacteria → Proteobacteria3957Open in IMG/M
3300005543|Ga0070672_100071525All Organisms → cellular organisms → Bacteria2760Open in IMG/M
3300005543|Ga0070672_100087011All Organisms → cellular organisms → Bacteria2514Open in IMG/M
3300005543|Ga0070672_100175751All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300005543|Ga0070672_100263641All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300005543|Ga0070672_100387919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1196Open in IMG/M
3300005564|Ga0070664_100015692All Organisms → cellular organisms → Bacteria → Proteobacteria6199Open in IMG/M
3300005578|Ga0068854_100009278All Organisms → cellular organisms → Bacteria → Proteobacteria6348Open in IMG/M
3300005617|Ga0068859_100819248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300005618|Ga0068864_102490917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300005718|Ga0068866_10570284All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300005719|Ga0068861_101731626All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300005836|Ga0074470_10903824All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300005843|Ga0068860_100212475All Organisms → cellular organisms → Bacteria1877Open in IMG/M
3300006046|Ga0066652_100998363All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300006755|Ga0079222_11160439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300006755|Ga0079222_12236102All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300006844|Ga0075428_102411099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300006881|Ga0068865_101194468All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300006894|Ga0079215_11552082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300006918|Ga0079216_11873316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300006954|Ga0079219_10925970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300007004|Ga0079218_10000097All Organisms → cellular organisms → Bacteria18530Open in IMG/M
3300007004|Ga0079218_10163437All Organisms → cellular organisms → Bacteria → Acidobacteria1645Open in IMG/M
3300009092|Ga0105250_10110253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1127Open in IMG/M
3300009094|Ga0111539_10546328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1350Open in IMG/M
3300009156|Ga0111538_10755963All Organisms → cellular organisms → Bacteria → Acidobacteria1231Open in IMG/M
3300009176|Ga0105242_11435563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300009177|Ga0105248_10149573All Organisms → cellular organisms → Bacteria → Proteobacteria2634Open in IMG/M
3300009177|Ga0105248_10496554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1376Open in IMG/M
3300009177|Ga0105248_12867190All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300009678|Ga0105252_10286112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300011119|Ga0105246_11680365All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300012038|Ga0137431_1245364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300012212|Ga0150985_108392826All Organisms → cellular organisms → Bacteria2437Open in IMG/M
3300012892|Ga0157294_10191650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300012955|Ga0164298_10899678All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300012964|Ga0153916_10162634All Organisms → cellular organisms → Bacteria → Proteobacteria2190Open in IMG/M
3300014326|Ga0157380_10402737All Organisms → cellular organisms → Bacteria → Proteobacteria1299Open in IMG/M
3300015371|Ga0132258_10240114All Organisms → cellular organisms → Bacteria → Proteobacteria4421Open in IMG/M
3300015371|Ga0132258_11437890All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300015374|Ga0132255_102950479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300017792|Ga0163161_11900223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300017965|Ga0190266_10027554All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300018051|Ga0184620_10221532All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300018083|Ga0184628_10000610All Organisms → cellular organisms → Bacteria18787Open in IMG/M
3300018469|Ga0190270_10013995All Organisms → cellular organisms → Bacteria4696Open in IMG/M
3300018469|Ga0190270_10440158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300018469|Ga0190270_11704315All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300018469|Ga0190270_11753543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300018469|Ga0190270_12613188All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300018476|Ga0190274_10320350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1456Open in IMG/M
3300018476|Ga0190274_10398253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1334Open in IMG/M
3300018476|Ga0190274_10608166All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300018476|Ga0190274_12517496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300018481|Ga0190271_10137180All Organisms → cellular organisms → Bacteria → Acidobacteria2336Open in IMG/M
3300018481|Ga0190271_10205940All Organisms → cellular organisms → Bacteria → Proteobacteria1963Open in IMG/M
3300018481|Ga0190271_11890798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300019361|Ga0173482_10193558All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300019377|Ga0190264_11708990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300020027|Ga0193752_1057207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1681Open in IMG/M
3300021082|Ga0210380_10113256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1204Open in IMG/M
3300023070|Ga0247755_1142517All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300025899|Ga0207642_10003147All Organisms → cellular organisms → Bacteria → Proteobacteria5176Open in IMG/M
3300025900|Ga0207710_10613913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300025901|Ga0207688_10387401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300025903|Ga0207680_10260435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1200Open in IMG/M
3300025907|Ga0207645_10900844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300025908|Ga0207643_10203905All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300025908|Ga0207643_10592476All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300025918|Ga0207662_10009073All Organisms → cellular organisms → Bacteria → Proteobacteria5463Open in IMG/M
3300025923|Ga0207681_10213984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1487Open in IMG/M
3300025923|Ga0207681_11870520All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300025925|Ga0207650_10261097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1405Open in IMG/M
3300025925|Ga0207650_10894023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300025925|Ga0207650_11757557All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300025926|Ga0207659_10813202All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300025926|Ga0207659_11295774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300025936|Ga0207670_10069186All Organisms → cellular organisms → Bacteria2434Open in IMG/M
3300025940|Ga0207691_10085560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2830Open in IMG/M
3300025940|Ga0207691_10170905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1903Open in IMG/M
3300025941|Ga0207711_10584091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1042Open in IMG/M
3300025972|Ga0207668_11008098All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300026075|Ga0207708_11133250All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300026088|Ga0207641_10493107All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300026116|Ga0207674_10547104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300026116|Ga0207674_10912073All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300026142|Ga0207698_10922190All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300027886|Ga0209486_10000089All Organisms → cellular organisms → Bacteria44232Open in IMG/M
3300028379|Ga0268266_10216500Not Available1759Open in IMG/M
3300028379|Ga0268266_11610523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300028380|Ga0268265_10925464All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300028381|Ga0268264_10947053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300031170|Ga0307498_10224551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300031943|Ga0310885_10360178All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300032002|Ga0307416_103322740All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300032012|Ga0310902_10958828All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300032144|Ga0315910_10224257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1415Open in IMG/M
3300032157|Ga0315912_10681118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300032157|Ga0315912_10877769All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300032421|Ga0310812_10124474All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300034147|Ga0364925_0155058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300034676|Ga0314801_171802All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere10.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere10.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.46%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.89%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1400260223300000363SoilMSLAVTVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR*
JGI10216J12902_10788495823300000956SoilMPLPVIVVGVVLSVTLVAVLLGYLVHRNAEHNDHEGSRR*
F14TB_10257253423300001431SoilAVTVAVVVLSVTLVAVLLGYLIHRNAERHDSQGGR*
Ga0062591_10113497523300004643SoilMPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR*
Ga0070676_1126482623300005328Miscanthus RhizosphereMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR*
Ga0070670_10163325213300005331Switchgrass RhizosphereRMSLAATVVSIVLGVTLVAGLLGYLVHRNAGRHDSKGVR*
Ga0070669_10005820023300005353Switchgrass RhizosphereMPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR*
Ga0070688_10046970913300005365Switchgrass RhizosphereMPLPVIVVAIVLSVTLVAVLLGYLVHRNAEHNDREGSRR*
Ga0070667_10186617923300005367Switchgrass RhizosphereMPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR*
Ga0070672_10003216433300005543Miscanthus RhizosphereMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR*
Ga0070672_10007152533300005543Miscanthus RhizosphereMPLAVTVSLIVLCVTLVGVFIGYLVHKNADRHDSEGGR*
Ga0070672_10008701133300005543Miscanthus RhizosphereMSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0070672_10017575123300005543Miscanthus RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR*
Ga0070672_10026364123300005543Miscanthus RhizosphereMPLAVTVVSIVLCVTLVVVLLGYLVHRNAERHDSKGDRS*
Ga0070672_10038791923300005543Miscanthus RhizosphereMMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR*
Ga0070664_10001569233300005564Corn RhizosphereMPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0068854_10000927833300005578Corn RhizosphereMSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGNR*
Ga0068859_10081924823300005617Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR*
Ga0068864_10249091713300005618Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0068866_1057028413300005718Miscanthus RhizosphereVTVVLVVLSVTLVAVLLGYLVHRNAERHDSRGGR*
Ga0068861_10173162623300005719Switchgrass RhizosphereMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0074470_1090382423300005836Sediment (Intertidal)MPLAATVVSIVLCVTIVAVLLGYLVHRNAERHDSKGDRS*
Ga0068860_10021247533300005843Switchgrass RhizosphereMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKG
Ga0066652_10099836313300006046SoilPLPVTVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR*
Ga0079222_1116043923300006755Agricultural SoilMSLAATVVSIVLSVTLVAVLLGYLVHRNADRHDSKGSR*
Ga0079222_1223610223300006755Agricultural SoilMTLAATVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR*
Ga0075428_10241109923300006844Populus RhizosphereMSLAATVASVVLIVTLVAVFLGYLVHRNAERHDSKGGR*
Ga0068865_10119446823300006881Miscanthus RhizosphereMPLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR*
Ga0079215_1155208223300006894Agricultural SoilMQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSQGGR*
Ga0079216_1187331623300006918Agricultural SoilMSLAATVASVVLIVTLVAVLLGYLVHRNAERLDSQGGR*
Ga0079219_1092597013300006954Agricultural SoilMALAVTVVSIVLCVTLVAVLLGYLVHRNAERHDAKGGR*
Ga0079218_1000009723300007004Agricultural SoilMQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSEGGR*
Ga0079218_1016343733300007004Agricultural SoilMPLPVIVVGVVLSVTLVAVLLGYLVHRNAEHNDREGSRR*
Ga0105250_1011025323300009092Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGIR*
Ga0111539_1054632823300009094Populus RhizosphereMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR*
Ga0111538_1075596323300009156Populus RhizosphereMMPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR*
Ga0105242_1143556323300009176Miscanthus RhizosphereMSLAVTVVLVVLSVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0105248_1014957343300009177Switchgrass RhizosphereMMPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR*
Ga0105248_1049655423300009177Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGNR*
Ga0105248_1286719023300009177Switchgrass RhizosphereMSLAVTVVSIVLCVTLVVVLLGYLVHRNAERHDSKGDRS*
Ga0105252_1028611223300009678SoilMQLAFTVALVVLCVTLVAVSLGFLVQRNAERHDSEGGR*
Ga0105246_1168036523300011119Miscanthus RhizosphereRSRMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGGR*
Ga0137431_124536413300012038SoilMQLAFSVVLVVLSVTIVAVVLGYLVQRNAERHDSEGGR*
Ga0150985_10839282633300012212Avena Fatua RhizosphereMSLAVTVVSIVASVTLVAVFLGYLVHRNADRHDSKGGR*
Ga0157294_1019165023300012892SoilMMPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR*
Ga0164298_1089967823300012955SoilMSLAATVVSIVLIVTLVAVLLGYLVHRNAERHDSKGIR*
Ga0153916_1016263423300012964Freshwater WetlandsMQLAATVVGVVLLVTVVTAVLGILIQKNAERHDREGGRR*
Ga0157380_1040273723300014326Switchgrass RhizosphereMMPLPVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR*
Ga0132258_1024011443300015371Arabidopsis RhizosphereMPLPVTVVSIVLAVTLVAVFVGYLVHKNAERHDREGGR*
Ga0132258_1143789023300015371Arabidopsis RhizosphereMSLAATVVTIVLGVTLVAVLLGYLVHRNAERHDSKGTR*
Ga0132255_10295047923300015374Arabidopsis RhizosphereMSLATTVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR*
Ga0163161_1190022313300017792Switchgrass RhizosphereMPLAVTVVLVVLSVTIAAVLIGYLIHKNAERHDREGGR
Ga0190266_1002755423300017965SoilMQLAFTVALVVLCVTLVAVALGYLVQRNAERHDSEGGR
Ga0184620_1022153223300018051Groundwater SedimentMSLAVTVVSIVLCVTLVVVLLGYFVHRNAERHDSKGGR
Ga0184628_1000061023300018083Groundwater SedimentMPLPVTVSLVVLCVTLVGVFIGYLVHKNADRHDSEGGR
Ga0190270_1001399543300018469SoilMPLPVMVTVVVLVFTLVGVLVGYLIHRNAERHDAEGGR
Ga0190270_1044015813300018469SoilMQLAFSVVLVVLSVTLVAVVLGYLVQRNAERHDSQGGR
Ga0190270_1170431523300018469SoilMPLPVTVTLVVLLFTLVGVLVGYLIHRNADRHDGEGGR
Ga0190270_1175354323300018469SoilMSLAVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR
Ga0190270_1261318823300018469SoilMPLPVMVGSVVLLFTLVAVLIGYLVHKNADRHDAEGGR
Ga0190274_1032035023300018476SoilMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR
Ga0190274_1039825333300018476SoilMPLPVTVTLVVLSFTLVGVLVGYLIHRNADRHDGERGR
Ga0190274_1060816623300018476SoilMPLPVMVGSVVLLFTLVGVLIGYLVHKNADRHDAEGGR
Ga0190274_1251749623300018476SoilMPLPVIVVGIVLSVTLVAVLLGYLVHKNAEHNDREGGRR
Ga0190271_1013718023300018481SoilMPLPVMVTVVVLVFTLVGVLVGYLIHRNADRHDAEGGR
Ga0190271_1020594033300018481SoilMPLPVIVVGVVLSVTLVAVLLGYLVHKNAEHNDREGGRR
Ga0190271_1189079823300018481SoilMPLPVTVTLVVLIITLVGVLLGYLIHRNADRHDGEGGR
Ga0173482_1019355823300019361SoilMPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR
Ga0190264_1170899023300019377SoilMPLPVIVVGVVLSVTLVVVLLGYLIHKNAEHNDREGSRR
Ga0193752_105720733300020027SoilMPLPVSVVSVVLCVTLVVLVVGYLVQKNAERHDRERGPR
Ga0210380_1011325623300021082Groundwater SedimentMPLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR
Ga0247755_114251713300023070Plant LitterLGVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR
Ga0207642_1000314733300025899Miscanthus RhizosphereMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR
Ga0207710_1061391323300025900Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR
Ga0207688_1038740123300025901Corn, Switchgrass And Miscanthus RhizosphereMSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR
Ga0207680_1026043523300025903Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR
Ga0207645_1090084423300025907Miscanthus RhizosphereMMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR
Ga0207643_1020390513300025908Miscanthus RhizosphereMPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR
Ga0207643_1059247623300025908Miscanthus RhizosphereMSLDATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR
Ga0207662_1000907333300025918Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGNR
Ga0207681_1021398433300025923Switchgrass RhizosphereMPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR
Ga0207681_1187052013300025923Switchgrass RhizosphereGVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR
Ga0207650_1026109733300025925Switchgrass RhizosphereMSLAATVVSIVLCVTLVAVLLGYLVQRNAERHDSKGSR
Ga0207650_1089402313300025925Switchgrass RhizosphereMPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGS
Ga0207650_1175755713300025925Switchgrass RhizosphereLRTRVRMSLAATVVSIVLGVTLVAGLLGYLVHRNAGRHDSKGVR
Ga0207659_1081320223300025926Miscanthus RhizosphereRSMMPLPVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR
Ga0207659_1129577423300025926Miscanthus RhizosphereMPLPVTVVGIVLGVTLVAVLLGYLVHRNAEHNDSEGSRR
Ga0207670_1006918633300025936Switchgrass RhizosphereMSLAVTVVSIVLGVTFLAVLLGYLVHRNAERHDAKGG
Ga0207691_1008556023300025940Miscanthus RhizosphereMPLAVTVSLIVLCVTLVGVFIGYLVHKNADRHDSEGGR
Ga0207691_1017090523300025940Miscanthus RhizosphereMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR
Ga0207711_1058409123300025941Switchgrass RhizosphereMPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR
Ga0207668_1100809813300025972Switchgrass RhizospherePLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR
Ga0207708_1113325013300026075Corn, Switchgrass And Miscanthus RhizosphereMPLPVTVTLIVLIVTLVGVVVGYLVHRNADRHDAEGGR
Ga0207641_1049310733300026088Switchgrass RhizosphereAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR
Ga0207674_1054710413300026116Corn RhizosphereMSLAVTVVLVVLSVTLVAVFLGYLVHRNAERHDSQ
Ga0207674_1091207313300026116Corn RhizosphereMSLAATVVSIVLSVTLVAVFLGYLVHRNAERHDSKGNR
Ga0207698_1092219033300026142Corn RhizosphereTLSKEPRVRMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR
Ga0209486_1000008973300027886Agricultural SoilMQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSEGGR
Ga0268266_1021650033300028379Switchgrass RhizosphereMPLPVTVVGIVLGVTLVAVLLGYLVHRNAEHNDREGSRR
Ga0268266_1161052323300028379Switchgrass RhizosphereLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGNR
Ga0268265_1092546423300028380Switchgrass RhizosphereMALAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR
Ga0268264_1094705323300028381Switchgrass RhizosphereMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSK
Ga0307498_1022455123300031170SoilMSLAVTVVLVVLSVTLVAVLLGYLVHRNAERHDSKGGR
Ga0310885_1036017813300031943SoilLLGVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR
Ga0307416_10332274013300032002RhizosphereRVMMPLAVTVVGVVLSVTLVAVLLGYLVHRNAEHNDREGSRR
Ga0310902_1095882813300032012SoilAATVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR
Ga0315910_1022425733300032144SoilMSLAATVTFVVLCVTLVAVLLGYLVQKNAERHDSQGGR
Ga0315912_1068111823300032157SoilMQLAVTVVSVVLSVTLVSVLLGYLVHRNAERHDREGGR
Ga0315912_1087776923300032157SoilMPLPVIVVGVVLSVTLVVVLLGYLVHRNAEHNDRDGGRR
Ga0310812_1012447423300032421SoilMSLAATVVSIVLGVTLVAGLLGYLVHRNADRHDSKGVR
Ga0364925_0155058_674_7903300034147SedimentMSLAATVASVVLVVTLVAVFLGYLVHRNAERHDSQGGR
Ga0314801_171802_154_2703300034676SoilMSLAVTVVSIVLCVTLVAVLLGYLVHRNADRHDSKGGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.