NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084751

Metagenome / Metatranscriptome Family F084751

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084751
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 78 residues
Representative Sequence MLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPV
Number of Associated Samples 108
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.21 %
% of genes near scaffold ends (potentially truncated) 97.32 %
% of genes from short scaffolds (< 2000 bps) 96.43 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.750 % of family members)
Environment Ontology (ENVO) Unclassified
(40.179 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.643 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 67.09%    β-sheet: 0.00%    Coil/Unstructured: 32.91%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF13480Acetyltransf_6 76.79
PF02780Transketolase_C 0.89
PF00893Multi_Drug_Res 0.89
PF01636APH 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2076Multidrug transporter EmrE and related cation transportersDefense mechanisms [V] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_188662All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300000550|F24TB_10164986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283883Open in IMG/M
3300000956|JGI10216J12902_115660961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283524Open in IMG/M
3300001686|C688J18823_10699239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283645Open in IMG/M
3300005148|Ga0066819_1011209All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300005174|Ga0066680_10111882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831680Open in IMG/M
3300005328|Ga0070676_10973157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283635Open in IMG/M
3300005335|Ga0070666_10185171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831462Open in IMG/M
3300005338|Ga0068868_100401813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831182Open in IMG/M
3300005339|Ga0070660_101882070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283510Open in IMG/M
3300005341|Ga0070691_10193697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831065Open in IMG/M
3300005344|Ga0070661_100476607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283996Open in IMG/M
3300005347|Ga0070668_101192641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283689Open in IMG/M
3300005365|Ga0070688_100642091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283816Open in IMG/M
3300005434|Ga0070709_10562113All Organisms → cellular organisms → Bacteria → Proteobacteria874Open in IMG/M
3300005455|Ga0070663_101535339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283593Open in IMG/M
3300005455|Ga0070663_101822571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283546Open in IMG/M
3300005456|Ga0070678_101508254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283630Open in IMG/M
3300005466|Ga0070685_11139817All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300005543|Ga0070672_102048569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283516Open in IMG/M
3300005548|Ga0070665_101813572All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300005563|Ga0068855_101399354All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005843|Ga0068860_102598039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283525Open in IMG/M
3300005844|Ga0068862_101565565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283665Open in IMG/M
3300005844|Ga0068862_101743237All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005844|Ga0068862_102360932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283543Open in IMG/M
3300006028|Ga0070717_10329753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831361Open in IMG/M
3300006031|Ga0066651_10312282All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300006038|Ga0075365_10657619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283740Open in IMG/M
3300006042|Ga0075368_10330962All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300006047|Ga0075024_100076083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831439Open in IMG/M
3300006051|Ga0075364_10550873All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300006163|Ga0070715_10940486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283535Open in IMG/M
3300006172|Ga0075018_10811681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283514Open in IMG/M
3300006353|Ga0075370_10249659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831051Open in IMG/M
3300006796|Ga0066665_10224021All Organisms → cellular organisms → Bacteria → Proteobacteria1473Open in IMG/M
3300006904|Ga0075424_100365364All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300009800|Ga0105069_1026552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283618Open in IMG/M
3300009840|Ga0126313_11335454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283593Open in IMG/M
3300010044|Ga0126310_10121578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831619Open in IMG/M
3300010166|Ga0126306_11482748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283563Open in IMG/M
3300010401|Ga0134121_11223076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283752Open in IMG/M
3300011003|Ga0138514_100078299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283699Open in IMG/M
3300012909|Ga0157290_10246836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283632Open in IMG/M
3300012916|Ga0157310_10560160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283509Open in IMG/M
3300012925|Ga0137419_11457891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283579Open in IMG/M
3300012929|Ga0137404_11192598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283700Open in IMG/M
3300012957|Ga0164303_10385329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283860Open in IMG/M
3300012957|Ga0164303_11439494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283517Open in IMG/M
3300012976|Ga0134076_10501525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283554Open in IMG/M
3300012987|Ga0164307_10172119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831448Open in IMG/M
3300012989|Ga0164305_11757505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283558Open in IMG/M
3300013306|Ga0163162_12723651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283569Open in IMG/M
3300013308|Ga0157375_13224164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283544Open in IMG/M
3300015077|Ga0173483_10148513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831032Open in IMG/M
3300015200|Ga0173480_10955756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283561Open in IMG/M
3300015241|Ga0137418_10729475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales754Open in IMG/M
3300017657|Ga0134074_1388191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283518Open in IMG/M
3300017792|Ga0163161_10674601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283858Open in IMG/M
3300017997|Ga0184610_1190971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283682Open in IMG/M
3300018054|Ga0184621_10093524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831057Open in IMG/M
3300018061|Ga0184619_10062462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831635Open in IMG/M
3300018071|Ga0184618_10415822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283568Open in IMG/M
3300018073|Ga0184624_10056862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831599Open in IMG/M
3300018082|Ga0184639_10504768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283609Open in IMG/M
3300018083|Ga0184628_10143222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831243Open in IMG/M
3300018465|Ga0190269_10695936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283709Open in IMG/M
3300018466|Ga0190268_10371466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283903Open in IMG/M
3300018469|Ga0190270_10740421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283981Open in IMG/M
3300019767|Ga0190267_10328264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283811Open in IMG/M
3300019871|Ga0193702_1033764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283647Open in IMG/M
3300019873|Ga0193700_1014462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831292Open in IMG/M
3300021444|Ga0213878_10490256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283540Open in IMG/M
3300023268|Ga0247765_1130343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283539Open in IMG/M
3300024288|Ga0179589_10358201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283664Open in IMG/M
3300025893|Ga0207682_10481918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283587Open in IMG/M
3300025914|Ga0207671_10503296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283966Open in IMG/M
3300025922|Ga0207646_11258443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283647Open in IMG/M
3300025923|Ga0207681_11266360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283619Open in IMG/M
3300025935|Ga0207709_10805093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283759Open in IMG/M
3300025938|Ga0207704_10710207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283833Open in IMG/M
3300025961|Ga0207712_10117546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02832006Open in IMG/M
3300025972|Ga0207668_11941921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283530Open in IMG/M
3300025981|Ga0207640_10201634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831508Open in IMG/M
3300025986|Ga0207658_11240862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283681Open in IMG/M
3300026329|Ga0209375_1231065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283644Open in IMG/M
3300028379|Ga0268266_11636125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283619Open in IMG/M
3300028381|Ga0268264_11099732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283803Open in IMG/M
3300028796|Ga0307287_10367741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283542Open in IMG/M
3300028828|Ga0307312_10111732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831704Open in IMG/M
3300028876|Ga0307286_10211346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283705Open in IMG/M
3300028884|Ga0307308_10357328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283700Open in IMG/M
3300030339|Ga0311360_10285598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831337Open in IMG/M
3300031152|Ga0307501_10001399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2653Open in IMG/M
3300031366|Ga0307506_10242662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283682Open in IMG/M
3300031421|Ga0308194_10360500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283520Open in IMG/M
3300031521|Ga0311364_11669101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283628Open in IMG/M
3300031547|Ga0310887_10878838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283567Open in IMG/M
3300031715|Ga0307476_11263021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283540Open in IMG/M
3300031731|Ga0307405_10372483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831109Open in IMG/M
3300031824|Ga0307413_10095860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831946Open in IMG/M
3300031890|Ga0306925_11134693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283788Open in IMG/M
3300031901|Ga0307406_10555053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283940Open in IMG/M
3300031908|Ga0310900_10681960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283821Open in IMG/M
3300031918|Ga0311367_10137716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02832578Open in IMG/M
3300031940|Ga0310901_10358602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283626Open in IMG/M
3300031946|Ga0310910_11159763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283600Open in IMG/M
3300032012|Ga0310902_11225719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283529Open in IMG/M
3300032126|Ga0307415_101807025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283591Open in IMG/M
3300032174|Ga0307470_11097306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283640Open in IMG/M
3300034127|Ga0370489_0084803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283922Open in IMG/M
3300034156|Ga0370502_0232319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283589Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.57%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.57%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.79%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.79%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009800Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034156Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_032480002199352025SoilMLTSDQTLPGFSLKLSASTKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVVSPSRCRASFS
F24TB_1016498623300000550SoilMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWL*
JGI10216J12902_11566096123300000956SoilMPTSDFALPGLGLKLSASTKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNF
C688J18823_1069923913300001686SoilMPTSDFALPSFGLRLSPGTKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFY
Ga0066819_101120913300005148SoilMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIV
Ga0066680_1011188223300005174SoilMLTSDSTLPGFGLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIVFAVQSIVQLMVPISA
Ga0070676_1097315713300005328Miscanthus RhizosphereMLTSDQTLPGFSLKLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVA
Ga0070666_1018517123300005335Switchgrass RhizosphereMLTSDQTLPGFSLKLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLE
Ga0068868_10040181313300005338Miscanthus RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEAL
Ga0070660_10188207023300005339Corn RhizosphereMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVF
Ga0070691_1019369723300005341Corn, Switchgrass And Miscanthus RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLE
Ga0070661_10047660713300005344Corn RhizosphereMLTSDQALPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDQPMTHWATWIGIVFYVLNFVAWLEALKTIP
Ga0070668_10119264113300005347Switchgrass RhizosphereMLTSDLILPGFSLKLSASTKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWI
Ga0070688_10064209123300005365Switchgrass RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLE
Ga0070709_1056211323300005434Corn, Switchgrass And Miscanthus RhizosphereMQTSDSPLPGFSLTLSASAKAYFKLAACAGLLAAGELLLKVGATARPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAV
Ga0070663_10153533913300005455Corn RhizosphereMLTSETALPGFSLKLSASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLN
Ga0070663_10182257123300005455Corn RhizosphereMPTSDFALPGFGFRLSPGTKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALK
Ga0070678_10150825423300005456Miscanthus RhizosphereMLTSETALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTI
Ga0070685_1113981713300005466Switchgrass RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPI
Ga0070672_10204856913300005543Miscanthus RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAW
Ga0070665_10181357223300005548Switchgrass RhizosphereMLTSETALLGFSLNLSASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAV
Ga0068855_10139935423300005563Corn RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPV
Ga0068860_10259803913300005843Switchgrass RhizosphereMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALK
Ga0068862_10156556523300005844Switchgrass RhizosphereMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTI
Ga0068862_10174323713300005844Switchgrass RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPV
Ga0068862_10236093213300005844Switchgrass RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGI
Ga0070717_1032975313300006028Corn, Switchgrass And Miscanthus RhizosphereMQTSDSTLPGFSLTLSASAKAYFKLAACAGLLAAGELLLKVGATARPDSPMTHWATWIG
Ga0066651_1031228213300006031SoilMLTSDQALPGLSLKLAASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMV
Ga0075365_1065761913300006038Populus EndosphereMLTSDQALPAFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWL
Ga0075368_1033096213300006042Populus EndosphereMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIV
Ga0075024_10007608313300006047WatershedsMLTSDQTLPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAW
Ga0075364_1055087323300006051Populus EndosphereMLTSDQALPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAW
Ga0070715_1094048613300006163Corn, Switchgrass And Miscanthus RhizosphereMLTSDPTLQGFSLELSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWL
Ga0075018_1081168123300006172WatershedsMLTSDSIQPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTNWATWIGIVFYVLNFVA
Ga0075370_1024965923300006353Populus EndosphereMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFY
Ga0066665_1022402113300006796SoilMLTSESTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWL
Ga0075424_10036536413300006904Populus RhizosphereMLTSDTIQPSFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGI
Ga0105069_102655213300009800Groundwater SandMLTSDLILPGFSLKLSTSAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAF
Ga0126313_1133545423300009840Serpentine SoilMLTFDQTLPGFSLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPLGIAFAVQSIVQLMVPISAWLFLH*
Ga0126310_1012157813300010044Serpentine SoilMLTSDQTLPGFSLKLSASTKAYLKLGACAGLLAAGELLLKIGATANPTSPMMHWTTWIGI
Ga0126306_1148274823300010166Serpentine SoilMLTSDQTLPGFSLTLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFY
Ga0134121_1122307623300010401Terrestrial SoilLTLPCFCQELSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDAPLTHWATWIGIFFYVL
Ga0138514_10007829913300011003SoilMLTSNQALPGFSLTLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEAL
Ga0157290_1024683613300012909SoilMLTSDLTLPGLSLKLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSVVQL
Ga0157310_1056016023300012916SoilLTLPGFSLKLSTTAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYV
Ga0137419_1145789113300012925Vadose Zone SoilMLTSDSTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISA
Ga0137404_1119259813300012929Vadose Zone SoilMLTSDSTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAVQSIVQ
Ga0164303_1038532923300012957SoilMLTSDLTLPGFSLKLSASAKAYIKLGACAGLLEARELLLKIGATAQPDSPMTHWTTWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVP
Ga0164303_1143949413300012957SoilMLTSETALPDFSPKISATTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLM
Ga0134076_1050152513300012976Grasslands SoilMLTSDSTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIP
Ga0164307_1017211913300012987SoilMLTSETALPDFSPKISATTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGI
Ga0164305_1175750523300012989SoilMLTSDLTLPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFV
Ga0163162_1272365113300013306Switchgrass RhizosphereMLTSESILPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWTTWIGI
Ga0157375_1322416413300013308Miscanthus RhizosphereMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWTTWIGIVFYVLNF
Ga0173483_1014851313300015077SoilMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWL
Ga0173480_1095575613300015200SoilMQTSETTLPSLGPKLSASTKAYVKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIG
Ga0137418_1072947513300015241Vadose Zone SoilMLTSDSTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWLFLHEQ
Ga0134074_138819113300017657Grasslands SoilMLTSDSTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWL
Ga0163161_1067460113300017792Switchgrass RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIV
Ga0184610_119097113300017997Groundwater SedimentMLTSDLILPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWAT
Ga0184621_1009352413300018054Groundwater SedimentMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSVVQLMVP
Ga0184619_1006246213300018061Groundwater SedimentMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSVVQLMVPISAWLFL
Ga0184618_1041582213300018071Groundwater SedimentMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSVVQLM
Ga0184624_1005686223300018073Groundwater SedimentMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQS
Ga0184639_1050476813300018082Groundwater SedimentMLTFDQTLPGFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLN
Ga0184628_1014322213300018083Groundwater SedimentMLTSDSTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQL
Ga0190269_1069593623300018465SoilMLTSDQALPGFSLKLSATTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFY
Ga0190268_1037146623300018466SoilMLTSDLILPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEAL
Ga0190270_1074042123300018469SoilMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFV
Ga0190267_1032826413300019767SoilMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVA
Ga0193702_103376413300019871SoilMLTSETALPGYSLKLSASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLE
Ga0193700_101446213300019873SoilMLTSDSIQPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSI
Ga0213878_1049025613300021444Bulk SoilMLTSDSTLPGVSLKLSASAKAYLKLGACAGLAAAGEVLLKIGASAQPDAPLTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQ
Ga0247765_113034313300023268Plant LitterMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSI
Ga0179589_1035820113300024288Vadose Zone SoilMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGI
Ga0207682_1048191813300025893Miscanthus RhizosphereMLTSDQTLPGFSLKLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIIFYVLNFVAWLEALKTIPVGIAFA
Ga0207671_1050329613300025914Corn RhizosphereMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDQPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0207646_1125844313300025922Corn, Switchgrass And Miscanthus RhizosphereMLTSDSIQLGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWTTWIGIAFYVL
Ga0207681_1126636013300025923Switchgrass RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWL
Ga0207709_1080509313300025935Miscanthus RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAW
Ga0207704_1071020713300025938Miscanthus RhizosphereMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQS
Ga0207712_1011754643300025961Switchgrass RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYV
Ga0207668_1194192113300025972Switchgrass RhizosphereMLTSDATLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLIVPISAWLFLH
Ga0207640_1020163413300025981Corn RhizosphereMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0207658_1124086223300025986Switchgrass RhizosphereMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWA
Ga0209375_123106523300026329SoilMLTSESTLPGFSLKLSASAKAYMKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEAL
Ga0268266_1163612513300028379Switchgrass RhizosphereMLTSETALLGFSLNLSASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQ
Ga0268264_1109973213300028381Switchgrass RhizosphereMLTSDLTLPGFSLKLSTTAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIA
Ga0307287_1036774123300028796SoilMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVL
Ga0307312_1011173223300028828SoilMLTSDQTLPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIAFYVLN
Ga0307286_1021134613300028876SoilMLTSDSIQPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0307308_1035732813300028884SoilMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGELLLKIGATAQPDAPMTHWATWIGIIFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWLF
Ga0311360_1028559823300030339BogMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMV
Ga0307501_1000139933300031152SoilMLTSDSIQPGFSLKLSASAKAYLKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0307506_1024266213300031366SoilMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0308194_1036050013300031421SoilMLTSDSIQPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWI
Ga0311364_1166910113300031521FenMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQLMVPISAWLFLH
Ga0310887_1087883813300031547SoilMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIP
Ga0307476_1126302123300031715Hardwood Forest SoilMLTSEQTLPGPGLNLSASARAYGKLGACAGLLAAGEILLKIGATAQPDSPMTHWATL
Ga0307405_1037248313300031731RhizosphereMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFA
Ga0307413_1009586013300031824RhizosphereMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEAL
Ga0306925_1113469323300031890SoilMLTSDSTLPGFIGLKLSASAKAYLKLGACAGLAAAGEVLLKIGATAQPDAPLTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSIVQL
Ga0307406_1055505313300031901RhizosphereMLTSDLTLPGLSLKLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIAFYVLNFVAWLEALKTIPVGIAFAV
Ga0310900_1068196013300031908SoilMLTSDQALPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWTTWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSI
Ga0311367_1013771613300031918FenMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKIGATAQPDSPMTHWATWIGIVFYVL
Ga0310901_1035860213300031940SoilMLTSESILPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAF
Ga0310910_1115976313300031946SoilMLTSDSTLPGFIGLKLSASAKAYLKLGACAGLAAAGEVLLKIGATAQPDAPLTHWATWIGIVFYVLNFVAW
Ga0310902_1122571923300032012SoilMLTSESILPGFSLKLSASTKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWTTWIGIVFYVLNFVAWLEALKTIP
Ga0307415_10180702523300032126RhizosphereMLTSDRALPGFSLKLSASAKAYIKLGACAGLLAAGEILLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQ
Ga0307470_1109730623300032174Hardwood Forest SoilMLTSDQALPGFSLKLSASAKAYIKLGACAGLLAAGELLLKVGATAQPDSPMTHWATWIGIAFYVL
Ga0370489_0084803_3_1733300034127Untreated Peat SoilMPTSDQTLPGFSLKLSATAKAYLKLGACAGLLAAGEVLLKIGATAQPDSPMTHWATW
Ga0370502_0232319_310_5883300034156Untreated Peat SoilMPTSDQTLPGFSLKLSATAKAYLKLGACAGLLAAGEVLLKIGATAQPDSPMTHWATWIGIVFYVLNFVAWLEALKTIPVGIAFAVQSVVQLIV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.