NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084473

Metagenome / Metatranscriptome Family F084473

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084473
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 39 residues
Representative Sequence TARIVQLPAGHDPNSYFVAGATAADFTRCLQQARPL
Number of Associated Samples 101
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.43 %
% of genes from short scaffolds (< 2000 bps) 89.29 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.321 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(16.071 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.643 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.06%    β-sheet: 6.25%    Coil/Unstructured: 79.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02899Phage_int_SAM_1 87.50
PF00589Phage_integrase 6.25
PF00733Asn_synthase 0.89
PF01610DDE_Tnp_ISL3 0.89
PF13619KTSC 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 87.50
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 87.50
COG3464TransposaseMobilome: prophages, transposons [X] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.32 %
UnclassifiedrootN/A2.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_12366631All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300001431|F14TB_102032582All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300001526|A105W1_1275811All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005181|Ga0066678_11075317All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005445|Ga0070708_101254198All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005568|Ga0066703_10631423All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005574|Ga0066694_10564949All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005610|Ga0070763_10405850All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005764|Ga0066903_101652160All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300005944|Ga0066788_10032433All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1192Open in IMG/M
3300006032|Ga0066696_10568056All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006047|Ga0075024_100204443All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300006052|Ga0075029_100792343All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006059|Ga0075017_100618415All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006176|Ga0070765_101690061All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006176|Ga0070765_102140123All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300006642|Ga0075521_10673913All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009053|Ga0105095_10710139All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300009088|Ga0099830_10066693All Organisms → cellular organisms → Bacteria2596Open in IMG/M
3300009525|Ga0116220_10131120All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300009616|Ga0116111_1054472All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300009662|Ga0105856_1005232All Organisms → cellular organisms → Bacteria4344Open in IMG/M
3300009824|Ga0116219_10659251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300010048|Ga0126373_10349383All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300010358|Ga0126370_12080818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300010398|Ga0126383_10676778All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300010398|Ga0126383_13648680All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300011269|Ga0137392_10398646All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300012096|Ga0137389_11499679All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012202|Ga0137363_11131876All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300012354|Ga0137366_10076531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2547Open in IMG/M
3300012360|Ga0137375_10992336All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012363|Ga0137390_10946242All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300012929|Ga0137404_11917537All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012948|Ga0126375_10112584All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300013770|Ga0120123_1150584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300014501|Ga0182024_10262242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2308Open in IMG/M
3300014839|Ga0182027_10373289All Organisms → cellular organisms → Bacteria → Proteobacteria1593Open in IMG/M
3300014839|Ga0182027_11463082All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300015264|Ga0137403_10651320All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300015372|Ga0132256_100528822All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300016357|Ga0182032_11425482All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300016404|Ga0182037_10588064All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300016422|Ga0182039_10986671All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300017948|Ga0187847_10558422All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300017959|Ga0187779_10693484All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300018025|Ga0187885_10043826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2332Open in IMG/M
3300018026|Ga0187857_10199925All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300018040|Ga0187862_10844477All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300018046|Ga0187851_10759173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300018057|Ga0187858_10385428All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300018086|Ga0187769_10356122All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300021407|Ga0210383_11043489All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300021432|Ga0210384_10259731All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300021432|Ga0210384_10568329All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300021476|Ga0187846_10159801All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300021476|Ga0187846_10376777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300021559|Ga0210409_11363530All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025324|Ga0209640_11270598All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025507|Ga0208188_1069966All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025898|Ga0207692_10888779All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300025939|Ga0207665_10984352All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300026221|Ga0209848_1077300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300026547|Ga0209156_10079542All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300027654|Ga0209799_1025322All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300027831|Ga0209797_10155207All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300027862|Ga0209701_10164464All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300027911|Ga0209698_10497648All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300028574|Ga0302153_10018514All Organisms → cellular organisms → Bacteria2327Open in IMG/M
3300028775|Ga0302231_10376276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300028906|Ga0308309_11717864All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300029636|Ga0222749_10395432All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300029636|Ga0222749_10493684All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300029913|Ga0311362_10139843All Organisms → cellular organisms → Bacteria2998Open in IMG/M
3300029913|Ga0311362_10639065All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300029914|Ga0311359_11081225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300029943|Ga0311340_10203349All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300029945|Ga0311330_10532596All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300029990|Ga0311336_10591672All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300030011|Ga0302270_10069356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2341Open in IMG/M
3300030020|Ga0311344_10984003All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300030339|Ga0311360_11201902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300030520|Ga0311372_10369108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2202Open in IMG/M
3300030520|Ga0311372_12303780All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300030688|Ga0311345_11287049All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300030943|Ga0311366_11263416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300031057|Ga0170834_102967979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300031344|Ga0265316_10521306All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300031524|Ga0302320_10402520All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300031524|Ga0302320_12206875All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031573|Ga0310915_10761074All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031719|Ga0306917_11355371All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031771|Ga0318546_10317108All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031798|Ga0318523_10410842All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031846|Ga0318512_10227827All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300031846|Ga0318512_10459025All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031938|Ga0308175_103177471All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031952|Ga0315294_11286036All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031981|Ga0318531_10356783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300032039|Ga0318559_10079823All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300032044|Ga0318558_10289005All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300032059|Ga0318533_10931446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300032067|Ga0318524_10255094All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300032401|Ga0315275_10447339All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300032782|Ga0335082_11368129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300032783|Ga0335079_10735260All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300032828|Ga0335080_11839320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300033158|Ga0335077_11480861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300034163|Ga0370515_0281466All Organisms → cellular organisms → Bacteria704Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.82%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.46%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.57%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.79%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.79%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.79%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.79%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.79%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.79%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1236663123300000550SoilRIVALPPGHDPNSYFMAGATAADFLTCLQQAQGL*
F14TB_10203258223300001431SoilRIVQLPQGHDPNSYFVAGADAVDFTGCLEGAQQV*
A105W1_127581123300001526PermafrostAGIRVHIVQLPHGHDPNSYFVAGASAADFTTHLQEAQRI*
Ga0066678_1107531723300005181SoilSGLHARIVRLPPGHDPNSYFATGATPADFLACLQEAQSL*
Ga0070708_10125419813300005445Corn, Switchgrass And Miscanthus RhizosphereLKNAGIPARVVLLPPGHDPNSYFVAGATAADFTDCLERAQRL*
Ga0066703_1063142323300005568SoilRIVSLPDGHDPNSYFTAGATRGDFLHCLDQARVL*
Ga0066694_1056494913300005574SoilALRLKSAGTQARIVQLPHGHDPNSYFIASATAADLTDCLERAQQL*
Ga0070763_1040585023300005610SoilACIVQLPAGHDPNSYFLAGATSADFTRCLQQARPL*
Ga0066903_10165216033300005764Tropical Forest SoilNARIVALPPGHDPNSYFMAGATAADFLACLQRAQGL*
Ga0066788_1003243313300005944SoilTARIVQLPAGHDPNSYFVAGATAADFTRCLQQARPL*
Ga0066696_1056805623300006032SoilAQRLANVGVTARIVQLPAGHDPNSYFVAGATAADFTSCLQQARPL*
Ga0075024_10020444323300006047WatershedsAHVVHLPAGHDPNSYFVAGATADDFAGCLARAQRP*
Ga0075029_10079234313300006052WatershedsLPAHIVQLPDGHDPNSYFVAGARAADFTARLREADRL*
Ga0075017_10061841523300006059WatershedsRQAGLPVRRVSLPWGHDPNSYLAGGGTAADFQRCLDQAQS*
Ga0070765_10169006123300006176SoilVGIRAHIVQLPHGHDPNSYFVAGATAADFTGCLERAQQL*
Ga0070765_10214012313300006176SoilGIQPHIVQLPHGQDPNSYFVAGAGAADFAARLKEAYTL*
Ga0075521_1067391323300006642Arctic Peat SoilRLQSAGIRACIVRLPHGHDPNSYFVAGASAADFAACLQKAESQ*
Ga0105095_1071013913300009053Freshwater SedimentHIVRLPHRHDPNSYFVAGATTADFTDCLERARRL*
Ga0099830_1006669353300009088Vadose Zone SoilLKLSIVELPDGHDPNSYFVAGATAADFVRCLDRAHPLHL*
Ga0116220_1013112013300009525Peatlands SoilAPIIRLPHGHDPNSYFVAGASAADFAACLGAAQRL*
Ga0116111_105447223300009616PeatlandGIHVHIVRLPEGFDPNSYFVAGASAAGFTARLREADRL*
Ga0105856_100523213300009662Permafrost SoilVTARIVQLPAGHDPNSYFVAGATAADFTRCLQQARPL*
Ga0116219_1065925123300009824Peatlands SoilPAPIIRLPHGHDPNSYFVAGASAADFAACLGAAQRL*
Ga0126373_1034938333300010048Tropical Forest SoilGLRACIVALPPGHDPNSYMVAGATAADFRACLQQAYSL*
Ga0126370_1208081813300010358Tropical Forest SoilLAARIVQLPAGHDPNNYFVAGATGADFTECLERAEQL*
Ga0126383_1067677823300010398Tropical Forest SoilARIVALPPRHDPNSYFAAGATAADFRACLEQAQSL*
Ga0126383_1364868023300010398Tropical Forest SoilGLAARIVQLPHRHDPNSYFVAGATAADFTDCLERAEGL*
Ga0137392_1039864623300011269Vadose Zone SoilLQARIVALPPGQDPNSYFAAGATASDFLACMEQAQSL*
Ga0137389_1149967913300012096Vadose Zone SoilGVLARVVRLPLGHDPNSYFVAGATATDFTVCLEQAQPL*
Ga0137363_1113187613300012202Vadose Zone SoilSAGIKAYIVQLPDGHDPNSYFVAGATAADFTDCLERAQPL*
Ga0137366_1007653133300012354Vadose Zone SoilTARSVELPDGNDPNSYFAAGATADDFARSLQEAQLVRCP*
Ga0137375_1099233623300012360Vadose Zone SoilLHRAGRRAYVLQLPDGHDPNSYFAAGASTADFTACLERARRS*
Ga0137390_1094624223300012363Vadose Zone SoilRIVALPSGQDPNSYFAAGATASDFVACMEHAQSV*
Ga0137404_1191753713300012929Vadose Zone SoilAGLTARIVRLPAGHDPNSYFLTGATAADFQACLAEAQSL*
Ga0126375_1011258413300012948Tropical Forest SoilHIVQLPHGHDPNSYFVAGATAADFTDCLERAQQL*
Ga0120123_115058413300013770PermafrostAVRVVQLPKGQDPASYFEAGATAVDFTHCLQQARTL*
Ga0181523_1042741313300014165BogQNRLRVRIVSLPVGHDPNSYFAAGATKSDFLRCLNQAQSL*
Ga0181528_1003049713300014167BogQNAGLHAHIVCLPAGQDPNSYFAAGATAADFLTCLKEAESL*
Ga0182024_1026224213300014501PermafrostTARIVQLPAGHDPNSYFVAGATAADFTSCLQQARPL*
Ga0182027_1037328933300014839FenAHIVQLPDGHDPNSYFVAGARAADFTARLREADRL*
Ga0182027_1146308223300014839FenAGIHVHIVRLPEGLDPHRYFVAGASAADLTPRLREAGRL*
Ga0137403_1063383613300015264Vadose Zone SoilQRLKSAALGARIVALPPGHEPNSYMVAGATAADFRACLQKADHL*
Ga0137403_1065132023300015264Vadose Zone SoilSAGLTARIVRLPAGHDPNSYFLTGATAADFQACLAEAQSL*
Ga0132256_10052882213300015372Arabidopsis RhizosphereAGLRARIVQLPQGHDPNSYFVAGADAVDFTGCLEGAQQV*
Ga0182032_1142548223300016357SoilQSAGIRAHIVRLPHGHDPNSYFVAGASAADFAGCLGAAESL
Ga0182037_1058806413300016404SoilKSLGFPVHIVHLPQGQDPNSYFVAGAAAADFNACLEQAEPL
Ga0182039_1098667123300016422SoilQLRDLGLRARIVDLPQGQDPNSYFVAGATAADFTACLQRAQPL
Ga0187847_1055842213300017948PeatlandVPARLVELPAGHDPNSYFVAGAAAADFADCLEGAHPL
Ga0187779_1069348423300017959Tropical PeatlandVGMRAHIVQLPHGHDPNSYFVAGATATDFTECLERAHQL
Ga0187885_1004382633300018025PeatlandTARLVVLPDGLDPNSYFTAGATATDFTDCLNQAQEVQP
Ga0187857_1019992523300018026PeatlandGVSVPARVVHLPAGHDPNSYFGAGATAADFADCLKGAQPL
Ga0187862_1084447723300018040PeatlandGAVVSIVPLPAGQDPNSYFVAGARAADFAHCLKGAQPL
Ga0187851_1075917323300018046PeatlandAAAGARARIVPLPPGHDPNSYFAAGATAADFTRCLQQAQPL
Ga0187858_1038542813300018057PeatlandKRAGLLARIVSLPPGHDPNSWFVAGATADDFARYLQRAQSV
Ga0187769_1035612223300018086Tropical PeatlandQDAGIAARIVRLPHGHDPNSYFLAGATTADFAALLEGAQLL
Ga0210383_1104348913300021407SoilAQRLAVAGIAAHVVQLPAGYDPNSYFAAGATAADFTDCLQQSKQL
Ga0210384_1025973133300021432SoilGVAARVVQLPSGHDPNSYFVAGATAGDFTGCLEEAQSS
Ga0210384_1056832923300021432SoilIHAHIVRLPHGHDPNSYFVAGATAADFTECLERAQQL
Ga0187846_1015980113300021476BiofilmKSAGIGARLVVLPLGHDPNSYFAGGATAADFTSCLEQAQQL
Ga0187846_1037677713300021476BiofilmRAGLAVSIVELPAGQDPNSYFVGGASVADFTLCLQRAQPL
Ga0210409_1136353013300021559SoilTVGVAARIVQLPAGHDPNSYFSCGATSADFAALLEQARPL
Ga0209640_1127059823300025324SoilMTPHPTAGIRAPIVQLPHGHDPNSYFVAGATAADFTDCLERAQQL
Ga0208188_106996623300025507PeatlandRLDGVSVPARVVHLPAGHDPNSYFGAGATAADFADCLKGAQPL
Ga0207692_1088877913300025898Corn, Switchgrass And Miscanthus RhizosphereNAGLPAHIVQLPDGLDPNSYFVAGARAADFTAHLQKADRL
Ga0207665_1098435223300025939Corn, Switchgrass And Miscanthus RhizosphereAGLKARIVALPTGHDPNSYFVAGATAADFLVCLQQAQPL
Ga0209848_107730013300026221Permafrost SoilQRLANVGVTARIVQLPAGHDPNSYFVASATAADFTRCLQQARPL
Ga0209156_1007954213300026547SoilHLVQLPEGHDPNSYFCTGATAADFAHCLEQAQGLRL
Ga0209799_102532213300027654Tropical Forest SoilDLSLRARIVDLPQGQDPNSYFVAGAASADFTACLQRAQPL
Ga0209797_1015520713300027831Wetland SedimentGTGASIVQLPLGHDPNSYFVAGATAADFATCLEQAHPL
Ga0209701_1016446413300027862Vadose Zone SoilLAARIVHLPATHDPNSFFCAGATAADFTRCLQEAR
Ga0209698_1049764813300027911WatershedsACIVQLPHGHDPNSYFAAGATAADFSDCLERAHQL
Ga0302153_1001851433300028574BogCAGVTVRIVRLPAGHDPNSYFVDGAAAADFAACLRGAQRL
Ga0302231_1037627613300028775PalsaRLQRSGGTARIVQLPAGHDPNSYFLAGATAADFAALLAGAQRL
Ga0308309_1171786423300028906SoilGIQPHIVQLPHGQDPNSYFVAGAGAADFAARLKEAYTL
Ga0222749_1039543223300029636SoilGVTACIVQLPAGHDPNSYFLAGATAADFIRCLQEARPL
Ga0222749_1049368423300029636SoilGAGIRARIVQLPHGHDPNSYFVAGATAADFTNCLERAERL
Ga0311362_1013984353300029913BogAGVTVRIVRLPAGHDPNSYFVAGATAADFAACLKGAQRL
Ga0311362_1063906543300029913BogLAHRLAITGIAAHVVQLPLGYDPNSYFVAGATAADFTDCLQQAKQL
Ga0311359_1108122513300029914BogVRIVQLPAGHDPNSYFVAGATAAHFAACLRGAQRL
Ga0311340_1020334913300029943PalsaSTGIEARIVQLPHGHDPNSYFVAGATAADFTQCLERTQPL
Ga0311330_1053259613300029945BogAGLTARIVHLPEGHDPNSYFVAGATPADFANCLDHAQPLES
Ga0311336_1059167223300029990FenDAGIRARTVQLPHGHDPNSYFLAGGTAADFTDCLERAQQ
Ga0302270_1006935633300030011BogTVRIVRLPAGHDPNSYFVAGATAADFAACLKGAQRL
Ga0311344_1098400313300030020BogAHRLAITGIAARVVQLPAGYDPNSYFVAGATAADFTACLQQAKQL
Ga0311360_1120190213300030339BogNVGVTARIVQLPAGHDPNSYFVAGATAADFTRCLQQARPL
Ga0311372_1036910833300030520PalsaGTTARIVQLPAGHDPNSYFVAGATAADFVACLQGAQRL
Ga0311372_1230378023300030520PalsaEARIVQLPHGHDPNSYFVAGATAADFTQCLERTQPL
Ga0311345_1128704923300030688BogAEVGVPARVVQLPAGHDPNSYFVAGASADDFLDCMERA
Ga0311366_1126341623300030943FenLANVGVAARIVQLPAGHDPNSYFVAGATAADFTRCLQQARPL
Ga0170834_10296797913300031057Forest SoilTARIVQLTAGHDPNSYFVAGATASDFTCCLQQARPL
Ga0265316_1052130623300031344RhizosphereGVAAPIVPLPHGHDPNSYFLAGATAADFAACLGAAQRL
Ga0302320_1040252033300031524BogTGIAARVVQLPAGYDPNSYFVAGATAADFTACLQQAKQL
Ga0302320_1220687513300031524BogLQCAGVTVRIVRLPAGHDPNSYFVAGATAADFAACLKGAQRL
Ga0310915_1076107423300031573SoilELQDAGLKVCIAELPEGQDPNSYFVAGATAADFVRCLNQASGHV
Ga0306917_1135537123300031719SoilLHVHVVRLPQGHDPNSYFVAGASAADFAARLREADRL
Ga0318546_1031710813300031771SoilPYIVQLPPGHDPNSYWAVGATAADFAARLTEAQPL
Ga0318523_1041084213300031798SoilLTARLVLLPPGHDPNSYLAAGATAADFTRCLERASQP
Ga0318512_1022782723300031846SoilVAARIVRLPAGHDPNSYFLAGATAADFTHCLEQARPL
Ga0318512_1045902513300031846SoilGLAARIVQLPHGYDPNSYFVTGATAADFTDCLERAEGL
Ga0308175_10317747123300031938SoilQRLQGVGIRAHIVQLPHGQDPNSYFVAGATAADFTDCLERAQQL
Ga0315294_1128603623300031952SedimentRAHIVVLPHAHDPNSYFLAGATPADFLRCLDRAQQVHA
Ga0318531_1035678313300031981SoilRAHILQLPHGHDPNSYFAAGATAADFTHCLERAQLL
Ga0318559_1007982313300032039SoilLQSIGIRAHIVQLPHGHDPNSYFVAGATATDFTGCLERTQQL
Ga0318558_1028900513300032044SoilLGFPVHIVHFPQGQDPNSYFVAGAAAADFNACLEQAEPL
Ga0318533_1093144623300032059SoilSGAGLKARIVALPPGHDPNSYFMAGATAADFLTCLQQAQGL
Ga0318524_1025509413300032067SoilGVGIPARVVQLPAGHDPNSYFVAGAPADDFLDCMERAQSL
Ga0315275_1044733933300032401SedimentAGGRAHMVQLPPGHDPNSYFVAGATAADFAARPQQAQRL
Ga0335082_1136812913300032782SoilTIGVYTRIVRLPAGDDPNSYFLSGATAADFTHRLQQARPL
Ga0335079_1073526013300032783SoilIRAYIVRLPHGHDPNSYFVAGATAVDFTDCLERAQQL
Ga0335080_1183932023300032828SoilLGIRAHIVQLPHGHDPNSYFVAGAVAADFTGCLERAQQV
Ga0335077_1148086113300033158SoilGLPVGIVELPDGHDPNSYFMAGATAADFSRCLDRAHSRPL
Ga0370515_0281466_1_1083300034163Untreated Peat SoilVHIVRLPEGLDPNSYFVAGASAADFTARLREADQL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.