


| Basic Information | |
|---|---|
| Family ID | F084445 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNYWLIFWTVWLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQRTHDHE |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.21 % |
| % of genes near scaffold ends (potentially truncated) | 26.79 % |
| % of genes from short scaffolds (< 2000 bps) | 83.04 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.321 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.26% β-sheet: 0.00% Coil/Unstructured: 39.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 21.43 |
| PF00474 | SSF | 21.43 |
| PF17128 | DUF5107 | 2.68 |
| PF13356 | Arm-DNA-bind_3 | 0.89 |
| PF00294 | PfkB | 0.89 |
| PF07787 | TMEM43 | 0.89 |
| PF13287 | Fn3_assoc | 0.89 |
| PF07715 | Plug | 0.89 |
| PF01547 | SBP_bac_1 | 0.89 |
| PF04820 | Trp_halogenase | 0.89 |
| PF01636 | APH | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.11 % |
| Unclassified | root | N/A | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_8817_length_1041_cov_7.040346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 2228664022|INPgaii200_c0808951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0880564 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101941839 | All Organisms → cellular organisms → Bacteria | 6365 | Open in IMG/M |
| 3300000890|JGI11643J12802_11127951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300000955|JGI1027J12803_100328296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1530 | Open in IMG/M |
| 3300004114|Ga0062593_102041939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300004463|Ga0063356_101240199 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300005093|Ga0062594_100683275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300005093|Ga0062594_103030005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005166|Ga0066674_10068735 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300005289|Ga0065704_10489812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300005290|Ga0065712_10010797 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300005290|Ga0065712_10476600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300005290|Ga0065712_10684030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300005293|Ga0065715_10580888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005294|Ga0065705_10316351 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005294|Ga0065705_10656353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300005294|Ga0065705_11073950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005295|Ga0065707_10126881 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300005328|Ga0070676_10044987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2570 | Open in IMG/M |
| 3300005334|Ga0068869_100266578 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300005345|Ga0070692_11106819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005354|Ga0070675_100086127 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300005354|Ga0070675_101445979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005456|Ga0070678_100967267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300005549|Ga0070704_100082137 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300005577|Ga0068857_100895083 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005577|Ga0068857_101346035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300005610|Ga0070763_10605301 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005719|Ga0068861_101785169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005840|Ga0068870_10968833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300005841|Ga0068863_100322881 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300006194|Ga0075427_10041835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300006196|Ga0075422_10465441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300006196|Ga0075422_10488476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300006844|Ga0075428_100011961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 9654 | Open in IMG/M |
| 3300006852|Ga0075433_10000411 | All Organisms → cellular organisms → Bacteria | 27322 | Open in IMG/M |
| 3300007788|Ga0099795_10000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 179944 | Open in IMG/M |
| 3300009012|Ga0066710_101011657 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009094|Ga0111539_10355132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300009094|Ga0111539_12818724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300009100|Ga0075418_10317437 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300009156|Ga0111538_10064993 | All Organisms → cellular organisms → Bacteria | 4648 | Open in IMG/M |
| 3300009156|Ga0111538_10250952 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300009156|Ga0111538_13936808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300009162|Ga0075423_10841444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300009176|Ga0105242_10631306 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300010362|Ga0126377_10030410 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
| 3300010399|Ga0134127_10591185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300010399|Ga0134127_11136704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300010400|Ga0134122_11023565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300012096|Ga0137389_10507262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300012360|Ga0137375_10545309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300012361|Ga0137360_11290776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012892|Ga0157294_10091385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300012900|Ga0157292_10290581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012916|Ga0157310_10056623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300012924|Ga0137413_11821996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012925|Ga0137419_10228118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300012925|Ga0137419_11188712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012927|Ga0137416_10492669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300012927|Ga0137416_11508852 | Not Available | 610 | Open in IMG/M |
| 3300012929|Ga0137404_10201413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300012930|Ga0137407_11493691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300012930|Ga0137407_12091806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012944|Ga0137410_10000064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 71516 | Open in IMG/M |
| 3300012944|Ga0137410_10684148 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300013308|Ga0157375_11088144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300014326|Ga0157380_10505886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300015241|Ga0137418_10087340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2820 | Open in IMG/M |
| 3300015372|Ga0132256_102086412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300015373|Ga0132257_100797360 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300017792|Ga0163161_12075720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018056|Ga0184623_10486248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300018469|Ga0190270_10243943 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300019356|Ga0173481_10260038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300019880|Ga0193712_1081708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300020170|Ga0179594_10376323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300025893|Ga0207682_10013435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3190 | Open in IMG/M |
| 3300025907|Ga0207645_10390232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300025908|Ga0207643_10762320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300025917|Ga0207660_10324358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300025923|Ga0207681_11703702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300025925|Ga0207650_11406146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300025926|Ga0207659_10038323 | All Organisms → cellular organisms → Bacteria | 3333 | Open in IMG/M |
| 3300025926|Ga0207659_10575869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300025926|Ga0207659_10690799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300025931|Ga0207644_11467318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300025934|Ga0207686_10497454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300025937|Ga0207669_10162516 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300025942|Ga0207689_10242913 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300026089|Ga0207648_10679363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300026116|Ga0207674_10705857 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300026116|Ga0207674_10938030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300026325|Ga0209152_10006896 | All Organisms → cellular organisms → Bacteria | 4055 | Open in IMG/M |
| 3300027512|Ga0209179_1000015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 50401 | Open in IMG/M |
| 3300027617|Ga0210002_1062345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300027717|Ga0209998_10039803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300027907|Ga0207428_10048973 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300027907|Ga0207428_10092443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2348 | Open in IMG/M |
| 3300027907|Ga0207428_10398357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300027909|Ga0209382_10924940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300028047|Ga0209526_10288706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300028802|Ga0307503_10160311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300030991|Ga0073994_12359871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300030991|Ga0073994_12392359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300031740|Ga0307468_100218186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300032012|Ga0310902_10350476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300032075|Ga0310890_11117762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300032180|Ga0307471_101498315 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300032180|Ga0307471_102084704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 8.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00973330 | 2140918013 | Soil | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE |
| INPgaii200_08089511 | 2228664022 | Soil | LAIAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE |
| ICChiseqgaiiDRAFT_08805642 | 3300000033 | Soil | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDXE* |
| INPhiseqgaiiFebDRAFT_1019418391 | 3300000364 | Soil | AWLAIAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE* |
| JGI11643J12802_111279512 | 3300000890 | Soil | LEPALKGGRMNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| JGI1027J12803_1003282961 | 3300000955 | Soil | MNYWLIFWTAWLAIAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE* |
| Ga0062593_1020419391 | 3300004114 | Soil | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYWDLRQMFSRLAEQGKHDHE* |
| Ga0063356_1012401992 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNHWLAFWTVWLVIAAASFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0062594_1006832752 | 3300005093 | Soil | MNHWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE* |
| Ga0062594_1030300052 | 3300005093 | Soil | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYSDLRQMFSRLAEQGKHDHE* |
| Ga0066674_100687352 | 3300005166 | Soil | MNYWLIFWTVSLMTAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTRDHE* |
| Ga0065704_104898121 | 3300005289 | Switchgrass Rhizosphere | MNHWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRSMFNRLAEQRTHDHE* |
| Ga0065712_100107971 | 3300005290 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAGISFAVITGIVMVKGYKDLRLMFSRLA |
| Ga0065712_104766002 | 3300005290 | Miscanthus Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAQQRTHDRE* |
| Ga0065712_106840302 | 3300005290 | Miscanthus Rhizosphere | SLVIAGISFAVITGIVMVKGYKDLRLMFSRLAEQRMHDRE* |
| Ga0065715_105808882 | 3300005293 | Miscanthus Rhizosphere | MNTWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE* |
| Ga0065705_103163512 | 3300005294 | Switchgrass Rhizosphere | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRSMFNRLAEQRTHDHE* |
| Ga0065705_106563531 | 3300005294 | Switchgrass Rhizosphere | MNYWLPFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDHE* |
| Ga0065705_110739502 | 3300005294 | Switchgrass Rhizosphere | GGRMNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRLMFSRLAEQRTHDHD* |
| Ga0065707_101268812 | 3300005295 | Switchgrass Rhizosphere | MNHWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0070676_100449872 | 3300005328 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0068869_1002665782 | 3300005334 | Miscanthus Rhizosphere | MHYWLIFWTVSLVIAGVSFALITGIVMVKGYWDLRQMFSRLAEQGKHDHE* |
| Ga0070692_111068192 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYWDLRLMFSRLAEQWKHDHE* |
| Ga0070675_1000861273 | 3300005354 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAGISFAVITGIVMVKGYKDLRLMFGRLAEERMHDRE* |
| Ga0070675_1014459792 | 3300005354 | Miscanthus Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVMVKGYRDLRSMFSRLAEQRTHDCE* |
| Ga0070678_1009672672 | 3300005456 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRLMFNRLAEQRTHDHE* |
| Ga0070704_1000821373 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHWLAFWTVWLVIAAASFAVITAIVMVKGYRDLRSMFSRLADQRTHDRE* |
| Ga0068857_1008950832 | 3300005577 | Corn Rhizosphere | MNYWLPFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0068857_1013460352 | 3300005577 | Corn Rhizosphere | MHYWLIFWAVSLVIAGVSFAVITGIVMVKGYWDLRQMFSRLAEQGKHDHE* |
| Ga0070763_106053012 | 3300005610 | Soil | MKHWLIFWTLCLVTAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHGHE* |
| Ga0068861_1017851691 | 3300005719 | Switchgrass Rhizosphere | AASFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0068870_109688332 | 3300005840 | Miscanthus Rhizosphere | MNYWLIFWTVWLVIAGVSFAVITGIVMIKGYKDLRLMFSRLAEQRTHDYE* |
| Ga0068863_1003228812 | 3300005841 | Switchgrass Rhizosphere | MNYWQIFWTAWLALAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE* |
| Ga0075427_100418351 | 3300006194 | Populus Rhizosphere | LVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0075422_104654411 | 3300006196 | Populus Rhizosphere | EARSAISDGRNMNYWLIFWTAWLAIAGTSFAVITAIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0075422_104884761 | 3300006196 | Populus Rhizosphere | WLAFWTVWLVIAAISFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0075428_1000119616 | 3300006844 | Populus Rhizosphere | MNHWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRG* |
| Ga0075433_100004118 | 3300006852 | Populus Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0099795_1000000147 | 3300007788 | Vadose Zone Soil | MNYWLIFWTVSLVVAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTHDHE* |
| Ga0066710_1010116572 | 3300009012 | Grasslands Soil | MNYWLIFWTVSLMTAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTRDHE |
| Ga0111539_103551324 | 3300009094 | Populus Rhizosphere | NYWLIFWTAWLAIAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE* |
| Ga0111539_128187242 | 3300009094 | Populus Rhizosphere | MNYWLIFWTAWLAIAGVSFAVITGIVMVMGYKDLRSMFSSLKEQRTHEHE* |
| Ga0075418_103174371 | 3300009100 | Populus Rhizosphere | NPWLAFWTVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAQQRTHDRE* |
| Ga0111538_100649934 | 3300009156 | Populus Rhizosphere | REAHSGIRDGCNMNYWLIFWTAWLAIAGVSFAVITGIVMVKGYKDLRSMFSSLKEQRTHDHE* |
| Ga0111538_102509521 | 3300009156 | Populus Rhizosphere | HWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRG* |
| Ga0111538_139368082 | 3300009156 | Populus Rhizosphere | MNHWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTRDRE* |
| Ga0075423_108414441 | 3300009162 | Populus Rhizosphere | TVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAQQRTHDRE* |
| Ga0105242_106313062 | 3300009176 | Miscanthus Rhizosphere | MNNWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE* |
| Ga0126377_100304104 | 3300010362 | Tropical Forest Soil | MNPWQAFWTVWLVIAGVSFAVITAIVTVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0134127_105911852 | 3300010399 | Terrestrial Soil | LTQDLTTHEGRRMNYWLIFWTVWLVIAGVSFAVITGIVMIKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0134127_111367042 | 3300010399 | Terrestrial Soil | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRLMFNRLAEHRTHDHE* |
| Ga0134122_110235652 | 3300010400 | Terrestrial Soil | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQRTRDHE* |
| Ga0137389_105072622 | 3300012096 | Vadose Zone Soil | MNYWLTFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHDHE* |
| Ga0137375_105453091 | 3300012360 | Vadose Zone Soil | TRVEGGGVNYWLAFWTIELVVAGISFDVITGIVTIKGYKDLRTMFSRLAEQRMDDNE* |
| Ga0137360_112907762 | 3300012361 | Vadose Zone Soil | MNYWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHDHE* |
| Ga0157294_100913852 | 3300012892 | Soil | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTYDHE* |
| Ga0157292_102905811 | 3300012900 | Soil | LIFWTVWLVIAGVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0157310_100566232 | 3300012916 | Soil | YWLIFWTVSLVIAGVSFAVITGIVMVKGYWDLRQMFSRLAEQGKHDHE* |
| Ga0137413_118219962 | 3300012924 | Vadose Zone Soil | MNFWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRVMFGRLAEQRAHDHD* |
| Ga0137419_102281182 | 3300012925 | Vadose Zone Soil | MNFWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHDRE* |
| Ga0137419_111887122 | 3300012925 | Vadose Zone Soil | VNYWEIFWTFWLVTAGVSFAVITGIVAVKGYRDLRNMFSGLAEQRTKGNE* |
| Ga0137416_104926692 | 3300012927 | Vadose Zone Soil | MNFWLIYWTVSLVTAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHDRE* |
| Ga0137416_115088522 | 3300012927 | Vadose Zone Soil | RIEGGGMNYWLVFWTIALVTAGVSFFVITGILSVKGYKDLRTMFSRLAEQRTDDNE* |
| Ga0137404_102014133 | 3300012929 | Vadose Zone Soil | MNYWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRVMFGRLAEQRTHDHD* |
| Ga0137407_114936911 | 3300012930 | Vadose Zone Soil | MNYWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTHDHE* |
| Ga0137407_120918062 | 3300012930 | Vadose Zone Soil | MNHWLAFWTLALVVAGISFGVITGIVTIKGYGDLRTMFSRLAQQRMDDNE* |
| Ga0137410_1000006414 | 3300012944 | Vadose Zone Soil | MNYWLIFWTAWLAIAGVSFAAITGIVMVKGYKDLRSMFSGLAEQRRQRHE* |
| Ga0137410_106841482 | 3300012944 | Vadose Zone Soil | MNYWLIFWTAWLAIAGVSFAVITGIVMVKGYKDLLSMFSGLAEQRTHDHE* |
| Ga0157375_110881442 | 3300013308 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAGISFAVITGIVMVKGYKDLRLMFGRLAEQRMHDRE* |
| Ga0157380_105058861 | 3300014326 | Switchgrass Rhizosphere | MNYWQIFWTAWLALAGVSFAVITAIVMVKGYKDLRSMFNRLAEQRTHDHE* |
| Ga0137418_100873402 | 3300015241 | Vadose Zone Soil | MNYWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFRRLAEQRTHDRE* |
| Ga0132256_1020864122 | 3300015372 | Arabidopsis Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAEQRTHDRE* |
| Ga0132257_1007973602 | 3300015373 | Arabidopsis Rhizosphere | MTHWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE* |
| Ga0163161_120757202 | 3300017792 | Switchgrass Rhizosphere | LIFWTASLVIAAVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE |
| Ga0184623_104862481 | 3300018056 | Groundwater Sediment | MNYWLIFWTVWLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQRTHDHE |
| Ga0190270_102439432 | 3300018469 | Soil | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRLMFNRLAEQRTHDHE |
| Ga0173481_102600382 | 3300019356 | Soil | MNHWLAFWTVWLVIAAASFAVITAIVMVNGYRDLRSMFSRLAEQRTHDRE |
| Ga0193712_10817081 | 3300019880 | Soil | MNYWLIFWTAWLAIAGVSFAVITGIVMVKGYRDLRSMFSGLAEQRTHDHE |
| Ga0179594_103763232 | 3300020170 | Vadose Zone Soil | MNYWLIFWTVSLVAAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTHDHE |
| Ga0207682_100134352 | 3300025893 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRLMFTRLAEQRTHDHE |
| Ga0207645_103902322 | 3300025907 | Miscanthus Rhizosphere | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYSDLRQMFSRLAEQGKHDHE |
| Ga0207643_107623202 | 3300025908 | Miscanthus Rhizosphere | MNYWLIFWTVWLVIAGVSFAVITGIVMIKGYKDLRLMFSRLAEQRTHDYE |
| Ga0207660_103243581 | 3300025917 | Corn Rhizosphere | MNHWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE |
| Ga0207681_117037022 | 3300025923 | Switchgrass Rhizosphere | MNYWLIFWTVWLVIAGVSFAVITGIVMIKGYKDLRLLFSRLAEQRTHDYE |
| Ga0207650_114061462 | 3300025925 | Switchgrass Rhizosphere | MNYWLIFWTASLVIAAVSFAVITGIVMVKGYRDLRLMFNRLAEQRTHDHE |
| Ga0207659_100383233 | 3300025926 | Miscanthus Rhizosphere | MNYWLIFWTASLVIAGISFAVITGIVMVKGYKDLRLMFGRLAEERMHDRE |
| Ga0207659_105758692 | 3300025926 | Miscanthus Rhizosphere | MHYWLIFWTVSLVIAGVSFAVITGIVMVKGYWDLRQMFSRLAEQGKHDHE |
| Ga0207659_106907992 | 3300025926 | Miscanthus Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVMVKGYRDLRSMFSRLAEQRTHDCE |
| Ga0207644_114673182 | 3300025931 | Switchgrass Rhizosphere | MNYWLIFWTASLVIAGISFAVITGIVMVKGYKDLRLMFGRLAEQRMHDRE |
| Ga0207686_104974542 | 3300025934 | Miscanthus Rhizosphere | MNNWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE |
| Ga0207669_101625162 | 3300025937 | Miscanthus Rhizosphere | MNYWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRLMFSRLAEQGTHDHE |
| Ga0207689_102429132 | 3300025942 | Miscanthus Rhizosphere | MHYWLIFWTVSLVIAGVSFALITGIVMVKGYWDLRQMFSRLAEQGKHDHE |
| Ga0207648_106793632 | 3300026089 | Miscanthus Rhizosphere | MNHWLAFWTVWLVIAAASFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE |
| Ga0207674_107058572 | 3300026116 | Corn Rhizosphere | MNYWLPFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE |
| Ga0207674_109380302 | 3300026116 | Corn Rhizosphere | MHYWLIFWAVSLVIAGVSFAVITGIVMVKGYWDLRQMFSRLAEQGKHDHE |
| Ga0209152_100068962 | 3300026325 | Soil | MKYWLAFWTVSLVTAGVSFAVITGIVTVKGYQDLPAMFRGLAKQRIDEHE |
| Ga0209179_100001546 | 3300027512 | Vadose Zone Soil | MNYWLIFWTVSLVVAGVSFAVITGIVVVKGYRDLRLMFSRLAEQRTHDHE |
| Ga0210002_10623451 | 3300027617 | Arabidopsis Thaliana Rhizosphere | KPSIGGDAMNHWLAFWTVWLVIAAASFAVITAIVMVKGYRDLRSMFSRLADQRTHDRE |
| Ga0209998_100398031 | 3300027717 | Arabidopsis Thaliana Rhizosphere | YWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE |
| Ga0207428_100489734 | 3300027907 | Populus Rhizosphere | MNHWLAFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRG |
| Ga0207428_100924431 | 3300027907 | Populus Rhizosphere | AFWTVWLVIAAVSFAVITAIVMVKGYRDLRSMFSRLAEQRTHDRE |
| Ga0207428_103983571 | 3300027907 | Populus Rhizosphere | PWLAFWTVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAQQRTHDRE |
| Ga0209382_109249402 | 3300027909 | Populus Rhizosphere | MNPWLAFWTVWLVIAAISFAVITAIVTVKGYRDLRSMFSRLAQQRTHDRE |
| Ga0209526_102887061 | 3300028047 | Forest Soil | VIAGVSFFVITGLVTVKGYKDLRTMFSRLAEQRTDDNE |
| Ga0307503_101603112 | 3300028802 | Soil | MNYWLIFWTAWLALAGVSFAVITGIVMVKGYKDLRSMFSGLREQRTHDRE |
| Ga0073994_123598712 | 3300030991 | Soil | IEGSGMNYWLVFWTVALVTAGVSFFVITGIVTVKGYKDLCTMFGRLAEQRTDDNE |
| Ga0073994_123923592 | 3300030991 | Soil | MNYWLVFWTVALVIAGVSFFVITVIVTVKGYKDLRTMFGRLAEQRTDDNE |
| Ga0307468_1002181861 | 3300031740 | Hardwood Forest Soil | MNYWLIFWTASLVIAGVSFAVITGIVVVKGYRDLRSMFSRLAETRTHDHE |
| Ga0310902_103504761 | 3300032012 | Soil | MNNWLIFWTVSLVIAGVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE |
| Ga0310890_111177621 | 3300032075 | Soil | IEGGRMNYWLIFWTASLVIAAVSFAVITGIVMVKGYKDLRSMFNRLAEQRTHDHE |
| Ga0307471_1014983152 | 3300032180 | Hardwood Forest Soil | MNYWLIFWTAWLVLAAVSFAVITGIVTVKGYRDLRSMFSRLTEQRTHDREGGSRSSSR |
| Ga0307471_1020847041 | 3300032180 | Hardwood Forest Soil | MNDWLIFWTASLVIAAISFAVITAIVMVKGYRDLRQMFDRLAEQRTHDH |
| ⦗Top⦘ |