Metagenome / Metatranscriptome Family F084424

Basic Information
Family ID	F084424
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	43 residues
Representative Sequence	VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILENKEWVQ
Number of Associated Samples	99
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	88.39 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	91.96 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Bacteria (55.357 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.214 % of family members)
Environment Ontology (ENVO)	Unclassified (31.250 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (49.107 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF00291	PALP	53.57
PF13356	Arm-DNA-bind_3	6.25
PF00697	PRAI	1.79
PF13620	CarboxypepD_reg	0.89
PF00275	EPSP_synthase	0.89
PF03734	YkuD	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0135	Phosphoribosylanthranilate isomerase	Amino acid transport and metabolism [E]	1.79
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.89
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.86 %
Unclassified	root	N/A	32.14 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.86 %
Unclassified	root	N/A	32.14 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.36 %
Unclassified	root	N/A	32.14 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	12.50 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.68 %
Unclassified	root	N/A	32.14 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	10.71 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.89 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	45.54 %
Unclassified	root	N/A	32.14 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	10.71 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	10.71 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7.14 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.68 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.89 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	10.71 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	2.68 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1.79 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.89 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.89 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	10.71 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples	2.68 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	1.79 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.89 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.89 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.89 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	1.79 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.89 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli	1.79 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.14 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	10.71 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	2.68 %
Rhizobium etli CNPAF512	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	1.79 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.89 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.89 %
Bradyrhizobium guangdongense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	0.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2067725001\|GPWNP_F5MPXY301BVTA5	Not Available	503	Open in IMG/M
2124908045\|KansclcFeb2_ConsensusfromContig552888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	828	Open in IMG/M
3300002073\|JGI24745J21846_1004712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1468	Open in IMG/M
3300002155\|JGI24033J26618_1038386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	662	Open in IMG/M
3300002911\|JGI25390J43892_10108444	Not Available	627	Open in IMG/M
3300005181\|Ga0066678_11074169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	519	Open in IMG/M
3300005184\|Ga0066671_10519824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	765	Open in IMG/M
3300005332\|Ga0066388_100753378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1573	Open in IMG/M
3300005332\|Ga0066388_101612838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1142	Open in IMG/M
3300005332\|Ga0066388_101622394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1140	Open in IMG/M
3300005332\|Ga0066388_104987270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	675	Open in IMG/M
3300005435\|Ga0070714_100118279	All Organisms → cellular organisms → Bacteria	2354	Open in IMG/M
3300005546\|Ga0070696_101348628	Not Available	607	Open in IMG/M
3300005713\|Ga0066905_101338719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	646	Open in IMG/M
3300005764\|Ga0066903_100483735	All Organisms → cellular organisms → Bacteria → Proteobacteria	2088	Open in IMG/M
3300005764\|Ga0066903_104742467	All Organisms → cellular organisms → Bacteria → Proteobacteria	723	Open in IMG/M
3300005764\|Ga0066903_106968534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	586	Open in IMG/M
3300005937\|Ga0081455_10656295	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	675	Open in IMG/M
3300006046\|Ga0066652_100217416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1654	Open in IMG/M
3300006049\|Ga0075417_10562252	Not Available	577	Open in IMG/M
3300006196\|Ga0075422_10245564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	751	Open in IMG/M
3300006605\|Ga0074057_10032497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	634	Open in IMG/M
3300006953\|Ga0074063_10119872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	823	Open in IMG/M
3300006953\|Ga0074063_13674119	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	801	Open in IMG/M
3300006954\|Ga0079219_11888551	Not Available	563	Open in IMG/M
3300006969\|Ga0075419_10382424	All Organisms → cellular organisms → Eukaryota	962	Open in IMG/M
3300009143\|Ga0099792_10770207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	628	Open in IMG/M
3300009147\|Ga0114129_12383316	Not Available	634	Open in IMG/M
3300009545\|Ga0105237_11419237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	701	Open in IMG/M
3300009792\|Ga0126374_10375532	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	984	Open in IMG/M
3300010048\|Ga0126373_11674436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	700	Open in IMG/M
3300010301\|Ga0134070_10020139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2166	Open in IMG/M
3300010358\|Ga0126370_10357932	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1182	Open in IMG/M
3300010358\|Ga0126370_10948628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	781	Open in IMG/M
3300010362\|Ga0126377_12807516	Not Available	561	Open in IMG/M
3300010376\|Ga0126381_100516234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense	1688	Open in IMG/M
3300010868\|Ga0124844_1069511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1293	Open in IMG/M
3300010868\|Ga0124844_1069512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1293	Open in IMG/M
3300010868\|Ga0124844_1071566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1278	Open in IMG/M
3300012189\|Ga0137388_11786942	Not Available	547	Open in IMG/M
3300012198\|Ga0137364_10530343	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	886	Open in IMG/M
3300012201\|Ga0137365_10793763	Not Available	691	Open in IMG/M
3300012356\|Ga0137371_11440725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	503	Open in IMG/M
3300012903\|Ga0157289_10227075	Not Available	624	Open in IMG/M
3300012907\|Ga0157283_10283764	Not Available	567	Open in IMG/M
3300012915\|Ga0157302_10045518	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300012923\|Ga0137359_10711581	All Organisms → cellular organisms → Bacteria → Proteobacteria	874	Open in IMG/M
3300012988\|Ga0164306_11491594	Not Available	579	Open in IMG/M
3300015200\|Ga0173480_10181749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1099	Open in IMG/M
3300016270\|Ga0182036_10625556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	865	Open in IMG/M
3300016294\|Ga0182041_10574772	All Organisms → cellular organisms → Bacteria → Proteobacteria	987	Open in IMG/M
3300016294\|Ga0182041_12332258	Not Available	501	Open in IMG/M
3300016341\|Ga0182035_10476639	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1062	Open in IMG/M
3300016371\|Ga0182034_11773060	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300016422\|Ga0182039_10758784	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	859	Open in IMG/M
3300016445\|Ga0182038_10895309	Not Available	782	Open in IMG/M
3300018429\|Ga0190272_13261333	Not Available	506	Open in IMG/M
3300018476\|Ga0190274_13189362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	552	Open in IMG/M
3300021081\|Ga0210379_10283415	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	723	Open in IMG/M
3300021178\|Ga0210408_10242393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1435	Open in IMG/M
3300021444\|Ga0213878_10573548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512	500	Open in IMG/M
3300025223\|Ga0207672_1009374	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300025898\|Ga0207692_10887802	Not Available	586	Open in IMG/M
3300025907\|Ga0207645_10616655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	737	Open in IMG/M
3300025960\|Ga0207651_11543896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	598	Open in IMG/M
3300026325\|Ga0209152_10402504	Not Available	537	Open in IMG/M
3300026548\|Ga0209161_10390286	Not Available	613	Open in IMG/M
3300027010\|Ga0207839_1042385	Not Available	515	Open in IMG/M
3300027050\|Ga0209325_1046824	Not Available	524	Open in IMG/M
3300027874\|Ga0209465_10009798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4245	Open in IMG/M
3300027909\|Ga0209382_10163967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2567	Open in IMG/M
3300028708\|Ga0307295_10135355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	679	Open in IMG/M
3300028711\|Ga0307293_10065659	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1137	Open in IMG/M
3300028744\|Ga0307318_10201659	Not Available	688	Open in IMG/M
3300028754\|Ga0307297_10231528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	653	Open in IMG/M
3300028768\|Ga0307280_10240069	All Organisms → cellular organisms → Bacteria → Proteobacteria	649	Open in IMG/M
3300028875\|Ga0307289_10036333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1951	Open in IMG/M
3300030336\|Ga0247826_11466067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	553	Open in IMG/M
3300031198\|Ga0307500_10034302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1164	Open in IMG/M
3300031231\|Ga0170824_115691220	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	706	Open in IMG/M
3300031543\|Ga0318516_10181277	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1213	Open in IMG/M
3300031543\|Ga0318516_10533142	Not Available	672	Open in IMG/M
3300031545\|Ga0318541_10712052	Not Available	560	Open in IMG/M
3300031546\|Ga0318538_10620715	Not Available	586	Open in IMG/M
3300031549\|Ga0318571_10363808	Not Available	557	Open in IMG/M
3300031561\|Ga0318528_10234037	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	984	Open in IMG/M
3300031680\|Ga0318574_10333383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	883	Open in IMG/M
3300031681\|Ga0318572_10444143	Not Available	772	Open in IMG/M
3300031682\|Ga0318560_10416765	Not Available	727	Open in IMG/M
3300031724\|Ga0318500_10537232	Not Available	589	Open in IMG/M
3300031765\|Ga0318554_10391942	Not Available	788	Open in IMG/M
3300031770\|Ga0318521_10358864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	865	Open in IMG/M
3300031778\|Ga0318498_10020529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	2792	Open in IMG/M
3300031793\|Ga0318548_10283256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	814	Open in IMG/M
3300031797\|Ga0318550_10349373	Not Available	716	Open in IMG/M
3300031821\|Ga0318567_10860280	Not Available	513	Open in IMG/M
3300031821\|Ga0318567_10889079	Not Available	504	Open in IMG/M
3300031833\|Ga0310917_10039978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2827	Open in IMG/M
3300031833\|Ga0310917_10837046	Not Available	620	Open in IMG/M
3300031896\|Ga0318551_10258254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	974	Open in IMG/M
3300031910\|Ga0306923_11126605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	843	Open in IMG/M
3300031946\|Ga0310910_10006148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	7223	Open in IMG/M
3300032001\|Ga0306922_10108299	All Organisms → cellular organisms → Bacteria → Proteobacteria	2946	Open in IMG/M
3300032051\|Ga0318532_10085329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1107	Open in IMG/M
3300032059\|Ga0318533_10247856	All Organisms → cellular organisms → Bacteria → Proteobacteria	1285	Open in IMG/M
3300032063\|Ga0318504_10142321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1100	Open in IMG/M
3300032076\|Ga0306924_11644701	Not Available	675	Open in IMG/M
3300032090\|Ga0318518_10499052	Not Available	623	Open in IMG/M
3300032180\|Ga0307471_103448352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	560	Open in IMG/M
3300033811\|Ga0364924_144344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	559	Open in IMG/M
3300034690\|Ga0364923_0060864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	907	Open in IMG/M
3300034820\|Ga0373959_0205594	Not Available	522	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.39%
Host-Associated	Host-Associated	11.61%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	87.50%
Plants	Host-Associated → Plants	11.61%
Aquatic	Environmental → Aquatic	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	85.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.57%
Floodplain	Environmental → Terrestrial → Floodplain	1.79%
Freshwater	Environmental → Aquatic → Freshwater	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.54%
Loam	Environmental → Terrestrial → Soil → Loam	15.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	33.93%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.57%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.68%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.68%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.89%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	23.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	11.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.25%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.36%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.36%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.79%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.79%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.89%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.89%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2067725001	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Host-Associated	Open in IMG/M
3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Host-Associated	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006605	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes)	Host-Associated	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027010	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes)	Environmental	Open in IMG/M
3300027050	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028744	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367	Environmental	Open in IMG/M
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031681	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032051	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032063	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300034690	Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17	Environmental	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F084424

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPWNP_00473620	2067725001	Soil	VVISRQKVIGWILIVVSVAYLAYFLRVRLFTPGPILEKKE
KansclcFeb2_14648360	2124908045	Soil	VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEN
JGI24745J21846_10047121	3300002073	Corn, Switchgrass And Miscanthus Rhizosphere	VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIE
JGI24033J26618_10383862	3300002155	Corn, Switchgrass And Miscanthus Rhizosphere	VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEK
JGI25390J43892_101084442	3300002911	Grasslands Soil	VIGRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILMLGT
Ga0066678_110741691	3300005181	Soil	LIGRQKVVGWVLIIVSTTYIVYFLRARLFMPGPIIEKKEWLQL
Ga0066671_105198241	3300005184	Soil	VISRQKVVGWSLILVSAGYIGYFLRVRLFEPGPTVASKEWVQLIGS
Ga0066388_1007533781	3300005332	Tropical Forest Soil	MLSRQKIVGWILIAVSAAYIAYFLRVRLFIPGPILENKEWV
Ga0066388_1016128381	3300005332	Tropical Forest Soil	VISRQKLVGWILIIVSAAFIAYFLRVRLFSPGPILEKKEWVQFIGSIVI
Ga0066388_1016223942	3300005332	Tropical Forest Soil	VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWV
Ga0066388_1049872701	3300005332	Tropical Forest Soil	MVISRQQVIGWILIVVSVAYIVYFLRVRLFDAGPIIERKEWVQFIGSFVT
Ga0070714_1001182791	3300005435	Agricultural Soil	VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQ
Ga0070696_1013486281	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSIV
Ga0066905_1013387191	3300005713	Tropical Forest Soil	MPVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENK
Ga0066903_1004837354	3300005764	Tropical Forest Soil	MRTVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENKE
Ga0066903_1047424672	3300005764	Tropical Forest Soil	VSPPVNTRNVISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILENKE
Ga0066903_1069685341	3300005764	Tropical Forest Soil	VISRQKLVGWILIIVSAAFIAYFLRVRLFSPGPILEKKE
Ga0081455_106562951	3300005937	Tabebuia Heterophylla Rhizosphere	VISRQKVVGWILIIVSVAFIVYFLRVRLFSPGPALEKKEWVNFI
Ga0066652_1002174163	3300006046	Soil	VISRQKIVGWILIVVSAAYIVYFLRVRLFTPGPILEKKEWVQFIGSIV
Ga0075417_105622521	3300006049	Populus Rhizosphere	VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEKKEWVQLISSIVILMLGTI
Ga0075422_102455642	3300006196	Populus Rhizosphere	VISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMI
Ga0074057_100324971	3300006605	Soil	VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMI
Ga0074063_101198721	3300006953	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFAPGPILENKEWAQFVGS
Ga0074063_136741192	3300006953	Soil	LTRQKLIGWILIAMAVAYIAYFLRVRLFEPGPVVEKKE
Ga0079219_118885512	3300006954	Agricultural Soil	VISRQKAVGWTLIVVSSAFIVYFLRERLLSPGPALEKKEWV
Ga0075419_103824241	3300006969	Populus Rhizosphere	VISRQKLVGWILIVVSAAYIAYFLRVRLFSPGPIL
Ga0099792_107702071	3300009143	Vadose Zone Soil	MISRQKVVGWILIIVSIAFIAWFLRVRLLDVGPVVEKKEWVQF
Ga0114129_123833162	3300009147	Populus Rhizosphere	VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQLIGSIVILMLGT
Ga0105237_114192371	3300009545	Corn Rhizosphere	VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVI
Ga0126374_103755321	3300009792	Tropical Forest Soil	VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQLIGSIVIL
Ga0126373_116744361	3300010048	Tropical Forest Soil	VISRQKIVGWILIVVSVAYIAYFLRVRLFTPGPILEDKE
Ga0134070_100201391	3300010301	Grasslands Soil	MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWVQFIGSF
Ga0126370_103579321	3300010358	Tropical Forest Soil	VISRQKIVGWILIVASAAYIAYFLRERLFTPGPILEKKEWVQFIGSIV
Ga0126370_109486281	3300010358	Tropical Forest Soil	VISRQKIVGWILIVVSIAYIAYFLRVRLFTPGPILENKEWVQFIGSIV
Ga0126377_128075161	3300010362	Tropical Forest Soil	VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWVQFIGSIVILMLGTI
Ga0126381_1005162341	3300010376	Tropical Forest Soil	MPVISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPM
Ga0124844_10695112	3300010868	Tropical Forest Soil	MQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEW
Ga0124844_10695122	3300010868	Tropical Forest Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEW
Ga0124844_10715662	3300010868	Tropical Forest Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEW
Ga0137388_117869421	3300012189	Vadose Zone Soil	LVGWILIVVSVAYLAYFLRVRLLEPGPVLEKKEWVQVIGSIVVFMLGTIN
Ga0137364_105303432	3300012198	Vadose Zone Soil	VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSIVVL
Ga0137365_107937632	3300012201	Vadose Zone Soil	VISRQKIVGWILIVVSVAFIAYFLRVRLFTPGPILEKKEWVQFIGSIVI
Ga0137371_114407251	3300012356	Vadose Zone Soil	LAVISRQKIVGWILIVVSVAYIAYFLRVRLFASGPV
Ga0157289_102270752	3300012903	Soil	VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEK
Ga0157283_102837641	3300012907	Soil	VISRQKAVGWTLIVVSSAFIVYFLRERLFSPGPVLEKKEWVQ
Ga0157302_100455182	3300012915	Soil	VISRQKAVGWTLIVVSSAFIVYFLRERLFSPGPALEKKEWVQFIGSIVIFMLGTA
Ga0137359_107115811	3300012923	Vadose Zone Soil	MRTVISRQKIVGWILIAVSAAYIAYFLRVRLFTPGP
Ga0164306_114915942	3300012988	Soil	VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILEN
Ga0173480_101817491	3300015200	Soil	VISRQKIVGWVLVIVSIAYIAYFLRVRLFAPGPMI
Ga0182036_106255562	3300016270	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVTLMLGTI
Ga0182041_105747722	3300016294	Soil	MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEW
Ga0182041_123322582	3300016294	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIVILMLG
Ga0182035_104766392	3300016341	Soil	VISRQKLIGWILIAVSAAYIAYFLRVRLLEVGPTV
Ga0182034_117730601	3300016371	Soil	MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIV
Ga0182039_107587842	3300016422	Soil	LSRQKSVGWILIAVSAAYIAYFLRVRLFEPGPAVASKEWVQVI
Ga0182038_108953091	3300016445	Soil	VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILML
Ga0190272_132613332	3300018429	Soil	VISRQKIVGWILVIVSTLFIAYFLKARVLTAGPPLEKAEWLRFIGSVVT
Ga0190274_131893622	3300018476	Soil	VISRQKVVGWILIVISTAFILYFLRTRLMVPGPII
Ga0210379_102834151	3300021081	Groundwater Sediment	VISRQKVVGWILIIVSTAFILYFLRVRLFGSGPALEKKEWVHFIGSIVILMVGTINVR
Ga0210408_102423932	3300021178	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFV
Ga0213878_105735482	3300021444	Bulk Soil	LTPSALIGRQRAVGWALIVVSAAFIAYFLRVRLLEPGTVIARKEWAEL
Ga0207672_10093741	3300025223	Corn, Switchgrass And Miscanthus Rhizosphere	VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEKKE
Ga0207692_108878022	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	VISRQKIVGWILIAASAAYIAYFLRVRLFTPGPILENKEWA
Ga0207645_106166551	3300025907	Miscanthus Rhizosphere	VVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEKK
Ga0207651_115438962	3300025960	Switchgrass Rhizosphere	VISRQKIVGWVLVIVSVGYIAYFLRVRLFAPGPMIEKK
Ga0209152_104025042	3300026325	Soil	MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWVQFIGSFVILMLGT
Ga0209161_103902862	3300026548	Soil	MRLSRQKLVGWILIVVSVAYIAYFLRVRLFTPGPILERKEWV
Ga0207839_10423851	3300027010	Tropical Forest Soil	MSRQKLVGWILIAVSVAYIAWFLRVRLFEPGPAVEKKEWVQFIGSIV
Ga0209325_10468242	3300027050	Forest Soil	VISRQKIVGWILIVASVAYITYFLRVRLFTPGPILENKEWVQLIGSI
Ga0209465_100097981	3300027874	Tropical Forest Soil	VISRQKVVGWILIVVSAAYIAYFLRVRLLDVGPVLEKKEWVQFIG
Ga0209382_101639674	3300027909	Populus Rhizosphere	VISRQKLVGWILIIVSAAYIAYFLRVRLFSPGPILEKKEWVQFIGSIVILMLGT
Ga0307295_101353551	3300028708	Soil	MISRQKVVGWILIIVSIAFIAWFVRVRLLDVGPVVEKKEWVQFIGSV
Ga0307293_100656591	3300028711	Soil	VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPIIEK
Ga0307318_102016591	3300028744	Soil	VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPIIEKKE
Ga0307297_102315281	3300028754	Soil	VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPMIEKK
Ga0307280_102400692	3300028768	Soil	VISRQKIVGWVLVIVSVAYIAYFLRVRLFAPGPMIE
Ga0307289_100363333	3300028875	Soil	MISRQKVVGWILIIVSIAFIAWFVRVRLFDVGPVV
Ga0247826_114660671	3300030336	Soil	VISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMIEKK
Ga0307500_100343022	3300031198	Soil	MISRQKVVGWILIIVSIAFIAWFVRVRLLDVGPVVEKKEWVQF
Ga0170824_1156912202	3300031231	Forest Soil	VINRQKVVGWLLIAVSAAYILYFLRLRLFTEGPPVVN
Ga0318516_101812771	3300031543	Soil	MSRQKLVGWILIAASVAYIAWFLRVRAFEPGPALEKKEWVHLIGSIVIF
Ga0318516_105331422	3300031543	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILEN
Ga0318541_107120522	3300031545	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPIL
Ga0318538_106207151	3300031546	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIVVLMLG
Ga0318571_103638081	3300031549	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKE
Ga0318528_102340372	3300031561	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQFIGSIV
Ga0318574_103333831	3300031680	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWVQ
Ga0318572_104441432	3300031681	Soil	VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQF
Ga0318560_104167652	3300031682	Soil	VISRQKIVGWILIVVSAAYIAYFLRVRLFEPGPVVAGKEWAQVIGSLLVLM
Ga0318500_105372321	3300031724	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVT
Ga0318554_103919421	3300031765	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENK
Ga0318521_103588642	3300031770	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFSPGPILENKEWVQFVGSIVTLMLG
Ga0318498_100205295	3300031778	Soil	VISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEW
Ga0318548_102832561	3300031793	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILEKKEWAQFIGS
Ga0318550_103493731	3300031797	Soil	VISRQKIVGWILIAVSAAYIAYFLRLRLFTPGPILENKEWVQFIGSIVILMLG
Ga0318567_108602802	3300031821	Soil	VISRQKIVGWILITVSAGYIAYFLRVRLFTPGPILENKEWVQFIGSIVILMLGTI
Ga0318567_108890792	3300031821	Soil	VISRQKIVGWILIAVSAGYIAYFLRVRLFTPGPILENKEWVQFIG
Ga0310917_100399783	3300031833	Soil	VPGPALSRQKLIGGILIVVSAAYIAWFVRVRLFTAGPAVEKKEWLQ
Ga0310917_108370461	3300031833	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFVGS
Ga0318551_102582541	3300031896	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFVGSIVTLMLG
Ga0306923_111266052	3300031910	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILEKKEWAQFIGSIVILMLG
Ga0310910_100061481	3300031946	Soil	VISRQKLVGWILIVVSAAYIAYFLRVRLFTPGPILEKKEWVQFIGSIVILM
Ga0306922_101082991	3300032001	Soil	MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPGPILENKEWV
Ga0318532_100853292	3300032051	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENK
Ga0318533_102478561	3300032059	Soil	MRTVISRQKIVGWILIVASVAYIAYFLRVRLFTPG
Ga0318504_101423212	3300032063	Soil	VISRQKIVGWILIAVSAAYIAYFLRVRLFTPGPILENKEWVQFI
Ga0306924_116447011	3300032076	Soil	MSRQKLVGWILIAVSVAYVVWFLRVRLFEPGPALE
Ga0318518_104990522	3300032090	Soil	VISRQKIVGWILIVVSAAYIAYFLRVRLFTPGPILENKEWVQ
Ga0307471_1034483522	3300032180	Hardwood Forest Soil	VISRQKLVGWILIVVSAAYIVYFLRVRLLDVGPIV
Ga0364924_144344_1_144	3300033811	Sediment	MVISRQQVIGWILIVVSVAYIAYFLRVRLFTPGPIVEKKEWVQFIGSF
Ga0364923_0060864_799_906	3300034690	Sediment	MISRQKIVGWVLVIVSIGYIAYFLRVRLFAPGPMIE
Ga0373959_0205594_405_521	3300034820	Rhizosphere Soil	MVISRQKIVGWALVIVSVAYIAYFLRVRLFAPGPVIEKK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign