NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084386

Metagenome / Metatranscriptome Family F084386

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084386
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 47 residues
Representative Sequence MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Number of Associated Samples 98
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 14.14 %
% of genes near scaffold ends (potentially truncated) 46.43 %
% of genes from short scaffolds (< 2000 bps) 76.79 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (66.071 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.857 % of family members)
Environment Ontology (ENVO) Unclassified
(41.071 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.429 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 82.35%    β-sheet: 0.00%    Coil/Unstructured: 17.65%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF07690MFS_1 23.21
PF04185Phosphoesterase 6.25
PF12730ABC2_membrane_4 2.68
PF08669GCV_T_C 2.68
PF13343SBP_bac_6 2.68
PF13302Acetyltransf_3 0.89
PF13416SBP_bac_8 0.89
PF12679ABC2_membrane_2 0.89
PF03928HbpS-like 0.89
PF08327AHSA1 0.89
PF13229Beta_helix 0.89
PF01323DSBA 0.89
PF00491Arginase 0.89
PF13683rve_3 0.89
PF01872RibD_C 0.89
PF10041DUF2277 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 6.25
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.89
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.89
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A66.07 %
All OrganismsrootAll Organisms33.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003990|Ga0055455_10073675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300003990|Ga0055455_10092339All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300004156|Ga0062589_100022049All Organisms → cellular organisms → Bacteria3041Open in IMG/M
3300004643|Ga0062591_101693849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea641Open in IMG/M
3300004803|Ga0058862_12826978Not Available694Open in IMG/M
3300005330|Ga0070690_100159220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum1546Open in IMG/M
3300005338|Ga0068868_100774627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales864Open in IMG/M
3300005343|Ga0070687_100096076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1649Open in IMG/M
3300005354|Ga0070675_102225202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005437|Ga0070710_10112832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1635Open in IMG/M
3300005439|Ga0070711_100526122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum978Open in IMG/M
3300005456|Ga0070678_100100958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2236Open in IMG/M
3300005543|Ga0070672_100550135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1002Open in IMG/M
3300005549|Ga0070704_100041999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3161Open in IMG/M
3300005618|Ga0068864_100488568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300005886|Ga0075286_1016330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300005889|Ga0075290_1002126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2187Open in IMG/M
3300006046|Ga0066652_100035590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3617Open in IMG/M
3300006237|Ga0097621_100418516Not Available1202Open in IMG/M
3300006573|Ga0074055_11485917Not Available1048Open in IMG/M
3300006579|Ga0074054_12094518Not Available850Open in IMG/M
3300006579|Ga0074054_12177872Not Available951Open in IMG/M
3300006580|Ga0074049_13023281Not Available618Open in IMG/M
3300006581|Ga0074048_13455968Not Available877Open in IMG/M
3300006755|Ga0079222_10074401Not Available1686Open in IMG/M
3300006806|Ga0079220_10092134All Organisms → cellular organisms → Bacteria → Terrabacteria group1550Open in IMG/M
3300006852|Ga0075433_11725278Not Available539Open in IMG/M
3300006881|Ga0068865_100556856Not Available964Open in IMG/M
3300006914|Ga0075436_100069979Not Available2425Open in IMG/M
3300006954|Ga0079219_10065629Not Available1636Open in IMG/M
3300009162|Ga0075423_13020640Not Available515Open in IMG/M
3300009174|Ga0105241_12003514Not Available570Open in IMG/M
3300010039|Ga0126309_10215947All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300010152|Ga0126318_10005243All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010152|Ga0126318_10426486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300010152|Ga0126318_10490536All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300010375|Ga0105239_11621025Not Available748Open in IMG/M
3300010400|Ga0134122_10673965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum967Open in IMG/M
3300011107|Ga0151490_1110579Not Available670Open in IMG/M
3300011119|Ga0105246_10468502All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300012212|Ga0150985_121690632Not Available1043Open in IMG/M
3300012285|Ga0137370_10951229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300012406|Ga0134053_1436816Not Available671Open in IMG/M
3300012469|Ga0150984_101272316Not Available941Open in IMG/M
3300012469|Ga0150984_108440277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea565Open in IMG/M
3300012955|Ga0164298_10171438Not Available1241Open in IMG/M
3300012957|Ga0164303_11297152Not Available538Open in IMG/M
3300012958|Ga0164299_11620644Not Available510Open in IMG/M
3300012960|Ga0164301_10007400All Organisms → cellular organisms → Bacteria4196Open in IMG/M
3300013297|Ga0157378_11051764Not Available850Open in IMG/M
3300014326|Ga0157380_10598311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum1090Open in IMG/M
3300015371|Ga0132258_10582747Not Available2807Open in IMG/M
3300017792|Ga0163161_11336485Not Available624Open in IMG/M
3300019269|Ga0184644_1389695Not Available738Open in IMG/M
3300019890|Ga0193728_1041102All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300020069|Ga0197907_10755136Not Available573Open in IMG/M
3300020075|Ga0206349_1577728Not Available617Open in IMG/M
3300020077|Ga0206351_10303021Not Available506Open in IMG/M
3300020080|Ga0206350_10532083Not Available1197Open in IMG/M
3300020081|Ga0206354_10061644Not Available502Open in IMG/M
3300020082|Ga0206353_11804570Not Available1537Open in IMG/M
3300021344|Ga0193719_10348446Not Available616Open in IMG/M
3300022467|Ga0224712_10070973All Organisms → cellular organisms → Bacteria → Terrabacteria group1414Open in IMG/M
3300022467|Ga0224712_10484887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea596Open in IMG/M
3300022467|Ga0224712_10652770Not Available516Open in IMG/M
3300025321|Ga0207656_10248685All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes870Open in IMG/M
3300025321|Ga0207656_10587197Not Available568Open in IMG/M
3300025556|Ga0210120_1012031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1720Open in IMG/M
3300025898|Ga0207692_10140839Not Available1372Open in IMG/M
3300025900|Ga0207710_10701214Not Available531Open in IMG/M
3300025901|Ga0207688_10546900Not Available727Open in IMG/M
3300025904|Ga0207647_10181105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum1224Open in IMG/M
3300025923|Ga0207681_10665772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum864Open in IMG/M
3300025934|Ga0207686_10250252Not Available1294Open in IMG/M
3300026003|Ga0208284_1002672Not Available1375Open in IMG/M
3300026035|Ga0207703_11489322Not Available651Open in IMG/M
3300026995|Ga0208761_1030675Not Available542Open in IMG/M
3300027765|Ga0209073_10252423Not Available686Open in IMG/M
3300027787|Ga0209074_10333938Not Available616Open in IMG/M
3300028708|Ga0307295_10166347Not Available617Open in IMG/M
3300028711|Ga0307293_10012519Not Available2399Open in IMG/M
3300028711|Ga0307293_10252602Not Available560Open in IMG/M
3300028814|Ga0307302_10086099Not Available1492Open in IMG/M
3300028828|Ga0307312_10390829Not Available913Open in IMG/M
3300030830|Ga0308205_1029375Not Available667Open in IMG/M
3300030858|Ga0102759_1913546Not Available529Open in IMG/M
3300030902|Ga0308202_1102898Not Available592Open in IMG/M
3300030902|Ga0308202_1117308Not Available565Open in IMG/M
3300031091|Ga0308201_10233335Not Available625Open in IMG/M
3300031092|Ga0308204_10346338Not Available510Open in IMG/M
3300031170|Ga0307498_10294062Not Available605Open in IMG/M
3300031184|Ga0307499_10125863Not Available729Open in IMG/M
3300031421|Ga0308194_10395965Not Available503Open in IMG/M
3300031938|Ga0308175_100084766Not Available2869Open in IMG/M
3300031938|Ga0308175_100583036Not Available1201Open in IMG/M
3300031938|Ga0308175_101838427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300031996|Ga0308176_11796950Not Available654Open in IMG/M
3300033433|Ga0326726_10165696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium2024Open in IMG/M
3300034090|Ga0326723_0022312All Organisms → cellular organisms → Bacteria2591Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere8.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.57%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.57%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.79%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025556Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030858Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055455_1007367523300003990Natural And Restored WetlandsMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSAL*
Ga0055455_1009233923300003990Natural And Restored WetlandsMWLLILLILALLVFGVWGAIKVAFWVILVALAVALVVGFLGRGRFGSRGAV*
Ga0062589_10002204953300004156SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY*
Ga0062591_10169384913300004643SoilLILAILVFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN*
Ga0058862_1282697813300004803Host-AssociatedLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0070690_10015922033300005330Switchgrass RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0068868_10077462723300005338Miscanthus RhizosphereMIWLLRLIFAILVFGVFGAIKLAFWVLLLAVLVAVVAGFLGRGLFTGTR*
Ga0070687_10009607623300005343Switchgrass RhizosphereMWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY*
Ga0070675_10222520213300005354Miscanthus RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVIAGFLGRGLFVRRSSL*
Ga0070710_1011283223300005437Corn, Switchgrass And Miscanthus RhizosphereMWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFTGRRGAL*
Ga0070711_10052612223300005439Corn, Switchgrass And Miscanthus RhizosphereMRASAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0070678_10010095823300005456Miscanthus RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL*
Ga0070672_10055013513300005543Miscanthus RhizosphereMWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0070704_10004199953300005549Corn, Switchgrass And Miscanthus RhizosphereMWLLLLLIVAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY*
Ga0066654_1065399513300005587SoilGIWGAVKLAFWVLLIALLVALVAGFLGRGLFTRTY*
Ga0068864_10048856823300005618Switchgrass RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSF*
Ga0075286_101633023300005886Rice Paddy SoilMWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSA
Ga0075289_100862713300005888Rice Paddy SoilIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL*
Ga0075290_100212623300005889Rice Paddy SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALVVAVVAGFLGRGLFVRRSSF*
Ga0066652_10003559033300006046SoilMWLLLLLILAVLLFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL*
Ga0097621_10041851643300006237Miscanthus RhizosphereIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL*
Ga0074055_1148591743300006573SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL*
Ga0074054_1209451833300006579SoilMWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLLARRSSL*
Ga0074054_1217787213300006579SoilRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL*
Ga0074049_1302328123300006580SoilRMWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL*
Ga0074048_1345596833300006581SoilGVWGAVKVAFWVLLIALAVAVVAGFLGRGLLVRRSSL*
Ga0079222_1007440123300006755Agricultural SoilMWLLLLFILALILFGIWGAIKLTFWVLLIALAVAVVAGFLGRGLFGTRGTV*
Ga0066659_1109563333300006797SoilFGVWGAIKLAFWVLLIALAVALIIGFLGRGLFGSRRGAI*
Ga0079220_1009213423300006806Agricultural SoilMRASAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRGLFVRRSSF*
Ga0075433_1172527813300006852Populus RhizosphereGVWGAVKVAFWVLLIALAVAIIAGFLGRGLFTRRSAL*
Ga0068865_10055685633300006881Miscanthus RhizosphereRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL*
Ga0075436_10006997953300006914Populus RhizosphereDAGIWLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0079219_1006562923300006954Agricultural SoilMWLLLLLILAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRALFVRRSSF*
Ga0075423_1302064013300009162Populus RhizosphereLLLLILAVLLLGVWGAVKVAFWVLLIALAVAIIAGFLGRVLFTRRSAL*
Ga0105241_1200351433300009174Corn RhizosphereALILFGVWGAIKVAFWVLLIALAVALIVGFLGRGLFGGRRGAI*
Ga0126309_1021594743300010039Serpentine SoilSMIWLLLFILAILIFGIGGAIKLTFWVILIALAVILIAAFLGRGLYSRA*
Ga0126318_1000524323300010152SoilLILALIVFGVWGAIKLAFWVLLIALIVALVVGLLGRGLFSGRRGTV*
Ga0126318_1042648613300010152SoilLILALIVFGVWGAIKLAFWVLLIALIVALVVGLLGRGLFGGRRGTV*
Ga0126318_1049053633300010152SoilILLILALILFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRGGAI*
Ga0134128_1248010933300010373Terrestrial SoilFGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI*
Ga0105239_1162102533300010375Corn RhizosphereLALILFGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI*
Ga0134122_1067396523300010400Terrestrial SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVALVVGFLGRGLFGSRRGAI*
Ga0151490_111057913300011107SoilLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL*
Ga0105246_1046850243300011119Miscanthus RhizosphereALILFGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI*
Ga0150985_12169063233300012212Avena Fatua RhizosphereMRIGMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAIIAGFLGRGLFVRRSSF*
Ga0137370_1095122913300012285Vadose Zone SoilILALILFGVWGAIKVAFWVLLIALAVALIAGFLGRGLFGSRRGAI*
Ga0134053_143681613300012406Grasslands SoilMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL*
Ga0150984_10127231633300012469Avena Fatua RhizosphereMRIGMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAIIAGFLGRGLFVRRSSL*
Ga0150984_10844027713300012469Avena Fatua RhizosphereDLLAILVFGVFGAIKIAFWVLLLAVLVAVVAGFLGRGLFTGTR*
Ga0150984_11062828823300012469Avena Fatua RhizosphereVFGVIGAIKLAFWVLLIALLVAVVAGFLGRSLFTTR*
Ga0164298_1017143843300012955SoilMWLLLLLILAVIIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL*
Ga0164303_1129715223300012957SoilMWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFSSRRGAL*
Ga0164299_1162064423300012958SoilYLPPDAGIWLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY*
Ga0164301_1000740053300012960SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL*
Ga0164307_1182728523300012987SoilVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFSSRRGAL*
Ga0157371_1126726533300013102Corn RhizosphereWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI*
Ga0157378_1105176433300013297Miscanthus RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSY*
Ga0157380_1059831123300014326Switchgrass RhizosphereMWLLLLLILAVLIFGVWGAVKVAFCVLLIALAVAVVAGFLGRGLFVRRSSF*
Ga0132258_1058274733300015371Arabidopsis RhizosphereMWLLLLILAVLVVGVWGAVKVAFWVLLIALAVAVIAGFLGRGLFVRRSSF*
Ga0163161_1133648523300017792Switchgrass RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF
Ga0184644_138969533300019269Groundwater SedimentLAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0193728_104110243300019890SoilMWFLILLILALIVFGVVGAIKLAFWVLLIALAVAVVAGFLGRGLFGSRRGAL
Ga0197907_1075513613300020069Corn, Switchgrass And Miscanthus RhizosphereWLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0206349_157772823300020075Corn, Switchgrass And Miscanthus RhizosphereLLLILALIVFGVWGAIKLAFWVLLIALIVALIVGFLGRGLFGGRRGAI
Ga0206351_1030302123300020077Corn, Switchgrass And Miscanthus RhizosphereLLILALIVFGVWGAIKLAFWVLLIALIVALIVGFLGRGLFGGRRGAI
Ga0206350_1053208313300020080Corn, Switchgrass And Miscanthus RhizosphereLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0206354_1006164423300020081Corn, Switchgrass And Miscanthus RhizosphereVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF
Ga0206354_1021979433300020081Corn, Switchgrass And Miscanthus RhizosphereVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0206353_1180457043300020082Corn, Switchgrass And Miscanthus RhizosphereLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0193719_1034844623300021344SoilPLRMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0224712_1007097333300022467Corn, Switchgrass And Miscanthus RhizosphereLILFGVWGAIKLACWVLLIALAVALIVGFLGRGLFGSRGGAI
Ga0224712_1048488713300022467Corn, Switchgrass And Miscanthus RhizosphereLLILAILVFGVIGAIKLALWVLLLAVLVAVVAGFLGRGLFTRTN
Ga0224712_1065277023300022467Corn, Switchgrass And Miscanthus RhizosphereLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0207656_1024868513300025321Corn RhizosphereLLILALILFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRRGAI
Ga0207656_1058719723300025321Corn RhizosphereMWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF
Ga0210120_101203123300025556Natural And Restored WetlandsMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSAL
Ga0207692_1014083923300025898Corn, Switchgrass And Miscanthus RhizosphereMWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFTGRRGAL
Ga0207710_1070121423300025900Switchgrass RhizosphereGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0207688_1054690013300025901Corn, Switchgrass And Miscanthus RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRR
Ga0207647_1018110533300025904Corn RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0207671_1002183573300025914Corn RhizosphereLFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRGGAI
Ga0207681_1066577223300025923Switchgrass RhizosphereMWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY
Ga0207644_1099025823300025931Switchgrass RhizosphereAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF
Ga0207686_1025025223300025934Miscanthus RhizosphereMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL
Ga0207658_1066628913300025986Switchgrass RhizosphereLVFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN
Ga0208284_100267223300026003Rice Paddy SoilLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALVVAVVAGFLGRGLFVRRSSF
Ga0207703_1148932233300026035Switchgrass RhizosphereLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF
Ga0208761_103067523300026995SoilPMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL
Ga0209073_1025242323300027765Agricultural SoilMRASAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRGLFVRRSSF
Ga0209074_1033393823300027787Agricultural SoilMWLLLLFILALILFGIWGAIKLTFWVLLIALAVAVVAGFLGRGLFGTRGTV
Ga0268265_1116764413300028380Switchgrass RhizosphereVFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN
Ga0307295_1016634713300028708SoilLRMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0307293_1001251923300028711SoilMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0307293_1025260223300028711SoilMTIRMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0307302_1008609943300028814SoilLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0307312_1039082923300028828SoilMRIRMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0308205_102937513300030830SoilLVFGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSL
Ga0102759_191354623300030858SoilLILALILFGVWGAIKLAFWVLLIALVVALIVGFLGRGLFGTRRGAL
Ga0308202_110289823300030902SoilFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0308202_111730813300030902SoilLVFGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSF
Ga0308201_1023333513300031091SoilFGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSL
Ga0308204_1034633823300031092SoilLLILLVLLVGVWGAIKIAFWVLVIALLVALVAGFLGRSLFAR
Ga0307498_1029406223300031170SoilMWLLLLLILAVLIFGVWGAVKIAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0307499_1012586323300031184SoilMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSF
Ga0308194_1039596523300031421SoilLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL
Ga0318534_1025861623300031544SoilVLGIWGAIKLAFWVLLIALLVALVAAFLGRGMFTRSGY
Ga0308175_10008476633300031938SoilMWLLLLLILAVLIFGVWGAVKIAFWVLLIALAVAIVAGFLGRGLFVRRSSL
Ga0308175_10058303633300031938SoilMWLLLLLILAVLLFGIWGAVKVAFWVLLIALAVAVIAGFLGRGLLTRRSAL
Ga0308175_10183842733300031938SoilVLILALILCGVWGAIKLAFWVLLIALVVALIVGFLGRGLFGTRRGAL
Ga0308176_1179695013300031996SoilLILALILFGVWGAIKVAFWVLLIALAVALIVGFLGRGLFGGRRGAI
Ga0326726_1016569633300033433Peat SoilMWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLLGRRSSF
Ga0326723_0022312_2434_25863300034090Peat SoilMWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLVRRSSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.