Basic Information | |
---|---|
Family ID | F084381 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 44 residues |
Representative Sequence | MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREED |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 71.43 % |
% of genes near scaffold ends (potentially truncated) | 9.82 % |
% of genes from short scaffolds (< 2000 bps) | 63.39 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.071 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.536 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.679 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01458 | SUFBD | 63.39 |
PF02401 | LYTB | 2.68 |
PF00903 | Glyoxalase | 2.68 |
PF00355 | Rieske | 1.79 |
PF03717 | PBP_dimer | 0.89 |
PF02782 | FGGY_C | 0.89 |
PF07992 | Pyr_redox_2 | 0.89 |
PF12697 | Abhydrolase_6 | 0.89 |
PF02073 | Peptidase_M29 | 0.89 |
PF03449 | GreA_GreB_N | 0.89 |
PF01565 | FAD_binding_4 | 0.89 |
PF01592 | NifU_N | 0.89 |
PF01909 | NTP_transf_2 | 0.89 |
PF13365 | Trypsin_2 | 0.89 |
PF00440 | TetR_N | 0.89 |
PF01883 | FeS_assembly_P | 0.89 |
PF01850 | PIN | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 63.39 |
COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 5.36 |
COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.89 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.89 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.07 % |
Unclassified | root | N/A | 8.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000858|JGI10213J12805_10092349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 694 | Open in IMG/M |
3300001213|JGIcombinedJ13530_108637672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 520 | Open in IMG/M |
3300002568|C688J35102_119247795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 661 | Open in IMG/M |
3300002568|C688J35102_120913086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2262 | Open in IMG/M |
3300003992|Ga0055470_10169971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 582 | Open in IMG/M |
3300004071|Ga0055486_10015087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1242 | Open in IMG/M |
3300005160|Ga0066820_1011242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 605 | Open in IMG/M |
3300005163|Ga0066823_10157277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 507 | Open in IMG/M |
3300005329|Ga0070683_100020936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5831 | Open in IMG/M |
3300005332|Ga0066388_100846292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1501 | Open in IMG/M |
3300005337|Ga0070682_100000009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 291635 | Open in IMG/M |
3300005366|Ga0070659_100223519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
3300005441|Ga0070700_100130368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1696 | Open in IMG/M |
3300005455|Ga0070663_100140924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1841 | Open in IMG/M |
3300005539|Ga0068853_100065475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3154 | Open in IMG/M |
3300005539|Ga0068853_100996131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300005548|Ga0070665_100000022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 379286 | Open in IMG/M |
3300005614|Ga0068856_100276868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
3300005719|Ga0068861_101240735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 722 | Open in IMG/M |
3300005841|Ga0068863_100000761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 32288 | Open in IMG/M |
3300005874|Ga0075288_1005823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1574 | Open in IMG/M |
3300005889|Ga0075290_1006295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1311 | Open in IMG/M |
3300006237|Ga0097621_100649161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 968 | Open in IMG/M |
3300006572|Ga0074051_11452158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300006578|Ga0074059_11807382 | Not Available | 1158 | Open in IMG/M |
3300006578|Ga0074059_12120893 | Not Available | 1293 | Open in IMG/M |
3300006642|Ga0075521_10576485 | Not Available | 553 | Open in IMG/M |
3300006755|Ga0079222_12656426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 504 | Open in IMG/M |
3300006846|Ga0075430_100240928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
3300006881|Ga0068865_100656292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
3300009098|Ga0105245_10000800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 28549 | Open in IMG/M |
3300009148|Ga0105243_12845296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 524 | Open in IMG/M |
3300009162|Ga0075423_12060555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 618 | Open in IMG/M |
3300009176|Ga0105242_10080238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2727 | Open in IMG/M |
3300009553|Ga0105249_10170303 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
3300010037|Ga0126304_10200850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1304 | Open in IMG/M |
3300010154|Ga0127503_10827275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3172 | Open in IMG/M |
3300010333|Ga0134080_10422883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 620 | Open in IMG/M |
3300010362|Ga0126377_10645415 | Not Available | 1107 | Open in IMG/M |
3300010362|Ga0126377_10668177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1089 | Open in IMG/M |
3300010362|Ga0126377_11621628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 721 | Open in IMG/M |
3300010400|Ga0134122_10232588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1547 | Open in IMG/M |
3300010400|Ga0134122_10982943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 825 | Open in IMG/M |
3300011119|Ga0105246_10152362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1751 | Open in IMG/M |
3300011119|Ga0105246_11903537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 571 | Open in IMG/M |
3300011119|Ga0105246_12524022 | Not Available | 506 | Open in IMG/M |
3300012908|Ga0157286_10031427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1246 | Open in IMG/M |
3300012912|Ga0157306_10235855 | Not Available | 636 | Open in IMG/M |
3300012914|Ga0157297_10328669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 587 | Open in IMG/M |
3300012916|Ga0157310_10024141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1603 | Open in IMG/M |
3300012929|Ga0137404_10134929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2035 | Open in IMG/M |
3300012943|Ga0164241_10005748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11481 | Open in IMG/M |
3300012943|Ga0164241_10031925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3986 | Open in IMG/M |
3300012985|Ga0164308_11760183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 576 | Open in IMG/M |
3300012988|Ga0164306_10133807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1668 | Open in IMG/M |
3300012989|Ga0164305_10269893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1240 | Open in IMG/M |
3300013296|Ga0157374_10184188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2041 | Open in IMG/M |
3300013296|Ga0157374_10197900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1967 | Open in IMG/M |
3300013308|Ga0157375_10020703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6017 | Open in IMG/M |
3300014267|Ga0075313_1135537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 626 | Open in IMG/M |
3300014270|Ga0075325_1000269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8534 | Open in IMG/M |
3300014270|Ga0075325_1002710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2814 | Open in IMG/M |
3300014325|Ga0163163_10662955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1107 | Open in IMG/M |
3300015064|Ga0167641_108801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1209 | Open in IMG/M |
3300015067|Ga0167640_101342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2367 | Open in IMG/M |
3300015068|Ga0167645_100010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 35718 | Open in IMG/M |
3300015168|Ga0167631_1011786 | Not Available | 1318 | Open in IMG/M |
3300015168|Ga0167631_1047321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 705 | Open in IMG/M |
3300015371|Ga0132258_10070721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8090 | Open in IMG/M |
3300015374|Ga0132255_100069613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4670 | Open in IMG/M |
3300018422|Ga0190265_10110474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2601 | Open in IMG/M |
3300018429|Ga0190272_10017586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3651 | Open in IMG/M |
3300018431|Ga0066655_10524951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 787 | Open in IMG/M |
3300018476|Ga0190274_10005410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7669 | Open in IMG/M |
3300018476|Ga0190274_10036148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3431 | Open in IMG/M |
3300018476|Ga0190274_11634031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 737 | Open in IMG/M |
3300019881|Ga0193707_1043909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1439 | Open in IMG/M |
3300019881|Ga0193707_1045723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1404 | Open in IMG/M |
3300019884|Ga0193741_1003203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4550 | Open in IMG/M |
3300021363|Ga0193699_10278009 | Not Available | 698 | Open in IMG/M |
3300021403|Ga0210397_10271749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1237 | Open in IMG/M |
3300021510|Ga0222621_1111209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 582 | Open in IMG/M |
3300023066|Ga0247793_1065626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 600 | Open in IMG/M |
3300025893|Ga0207682_10000060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 46992 | Open in IMG/M |
3300025932|Ga0207690_10162749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1665 | Open in IMG/M |
3300025934|Ga0207686_10110265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1855 | Open in IMG/M |
3300025938|Ga0207704_10603194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 899 | Open in IMG/M |
3300025944|Ga0207661_10014769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5729 | Open in IMG/M |
3300025944|Ga0207661_11352751 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025961|Ga0207712_10850326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 804 | Open in IMG/M |
3300025981|Ga0207640_10048459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2747 | Open in IMG/M |
3300026035|Ga0207703_10000020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 251603 | Open in IMG/M |
3300026041|Ga0207639_10016308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5253 | Open in IMG/M |
3300026051|Ga0208911_1000057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6716 | Open in IMG/M |
3300026051|Ga0208911_1000575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3017 | Open in IMG/M |
3300026075|Ga0207708_10029175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4180 | Open in IMG/M |
3300026078|Ga0207702_10193731 | Not Available | 1880 | Open in IMG/M |
3300026088|Ga0207641_10001906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20029 | Open in IMG/M |
3300026118|Ga0207675_101194647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 781 | Open in IMG/M |
3300026121|Ga0207683_10117248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2387 | Open in IMG/M |
3300027310|Ga0207983_1001832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2243 | Open in IMG/M |
3300027523|Ga0208890_1020276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 952 | Open in IMG/M |
3300027524|Ga0208998_1003771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2254 | Open in IMG/M |
3300027650|Ga0256866_1132557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 675 | Open in IMG/M |
3300027761|Ga0209462_10010901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1460 | Open in IMG/M |
3300028784|Ga0307282_10106761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1304 | Open in IMG/M |
3300028802|Ga0307503_10378877 | Not Available | 733 | Open in IMG/M |
3300031200|Ga0307496_10000246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3846 | Open in IMG/M |
3300031228|Ga0299914_10000125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 44510 | Open in IMG/M |
3300031965|Ga0326597_10378286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1582 | Open in IMG/M |
3300034128|Ga0370490_0026448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1934 | Open in IMG/M |
3300034965|Ga0370497_0000224 | All Organisms → cellular organisms → Bacteria | 9710 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.36% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 4.46% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.46% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.79% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.79% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015064 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10213J12805_100923492 | 3300000858 | Soil | MAWLLPLAHVSHWLWVLYLPPILIVALSVIGSTLRERRRKD* |
JGIcombinedJ13530_1086376722 | 3300001213 | Wetland | MLPLAHAGHYLWVLYLPPVLIVLASIIRTTLAERRERRSRGSR* |
C688J35102_1192477952 | 3300002568 | Soil | MLPLAHVGHWLWVLYLPPILIVIGSIVRSKILERRQSRDQAESQ |
C688J35102_1209130862 | 3300002568 | Soil | VQTGSNTEPMARLLPIAHAGHLLWVLYLPPILIVGASIVRTAISDRRKKRND* |
Ga0055470_101699711 | 3300003992 | Natural And Restored Wetlands | MHESLLVPLAHAGHWLWLLYVPPILIVLGSIVRTALAERRSRREADRSSD* |
Ga0055486_100150872 | 3300004071 | Natural And Restored Wetlands | MAVLVPLAHAGHWLWVLYLPPILVVAGSLLRSTVRERRQKKDD* |
Ga0066820_10112422 | 3300005160 | Soil | MAILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR* |
Ga0066823_101572772 | 3300005163 | Soil | TEDMAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREED* |
Ga0070683_1000209363 | 3300005329 | Corn Rhizosphere | MGVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED* |
Ga0066388_1008462921 | 3300005332 | Tropical Forest Soil | VIPVAHAGHWLWVLYLPPVAIVAFSLTRSKLNERRERKRRTD* |
Ga0070682_10000000915 | 3300005337 | Corn Rhizosphere | MAVLLPLAHTGHWLWVLYLPPLLIVLGSLLRTALSERRKERND* |
Ga0070659_1002235191 | 3300005366 | Corn Rhizosphere | MAALLPVAHATHWLWVLYVPPVLIVLVSIVRTTLRQRRANRKS* |
Ga0070700_1001303682 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFPLPLAHVTHWLWVLYLPPVLIVLASIVKTTLSERRKKRDD* |
Ga0070663_1001409242 | 3300005455 | Corn Rhizosphere | MVPVAHVGHWLWALYLPPVLIVVGSIARTSLSERREKKKGD* |
Ga0068853_1000654753 | 3300005539 | Corn Rhizosphere | MALPIPLAHVGHWLWVLYLPPVLIVIGSLARSTLAERRRKREEK* |
Ga0068853_1009961312 | 3300005539 | Corn Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQDRDED* |
Ga0070665_100000022103 | 3300005548 | Switchgrass Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREEA* |
Ga0068856_1002768683 | 3300005614 | Corn Rhizosphere | MAVLTPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREESRRD* |
Ga0068861_1012407352 | 3300005719 | Switchgrass Rhizosphere | MAVLVPLAHAGHWLWVLYLPPLLLVIGSLLRTTLSERRKKRED* |
Ga0068863_10000076119 | 3300005841 | Switchgrass Rhizosphere | VALLLPVAHAGHWLWVLYLPPVLIVVGSILRTTISERRKKRDD* |
Ga0075288_10058232 | 3300005874 | Rice Paddy Soil | MALLLPAAHAGHWLWVLYVPPVLIVAGSILRTKLRERRKGPQS* |
Ga0075290_10062952 | 3300005889 | Rice Paddy Soil | MALLLPAAHSGHWLWVLYVPPVLIVAGSILRTKLRERRKGPQS* |
Ga0097621_1006491612 | 3300006237 | Miscanthus Rhizosphere | MALLVPAAHVGHWLWALYLPPVLIVLGSIARTSLAERRRKRRD* |
Ga0074051_114521582 | 3300006572 | Soil | VALLLPFAHTGHWLWVLYLPPILIVAGSILRTKLRERRKGPED* |
Ga0074059_118073821 | 3300006578 | Soil | ILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR* |
Ga0074059_121208932 | 3300006578 | Soil | MAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREED* |
Ga0075521_105764852 | 3300006642 | Arctic Peat Soil | MLTRVVIVLPVAHVGHYLWALYLPPVLIVIGSIVRAKVLERREKRDKD* |
Ga0079222_126564262 | 3300006755 | Agricultural Soil | MAVLVPLAHAGHWLWILYLPPVLIVVVSLARSTLAERRKK |
Ga0075430_1002409282 | 3300006846 | Populus Rhizosphere | VALFLPLAHATHWLWVLYLPPILIVAGSILRTTLVERRKKRD* |
Ga0068865_1006562922 | 3300006881 | Miscanthus Rhizosphere | MAVLVPLAHAGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED* |
Ga0105245_100008003 | 3300009098 | Miscanthus Rhizosphere | MAVLTPLAHVGHWLWALYLPPVLIVVGSLARTTFVERRKKREED* |
Ga0105243_128452961 | 3300009148 | Miscanthus Rhizosphere | MALLVPVAHVGHWLWALYLPPILIVGVSLLRTTLLERRRKHADPHAGGT |
Ga0075423_120605552 | 3300009162 | Populus Rhizosphere | MATLVPLAHVGHWLWLLYVPPVLLVFASIVRTTLAERGRKRSRDSR* |
Ga0105242_100802382 | 3300009176 | Miscanthus Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQSRKED* |
Ga0105249_101703033 | 3300009553 | Switchgrass Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVAASIARSTLTERRKKREED* |
Ga0126304_102008502 | 3300010037 | Serpentine Soil | MATLLPLAHTGHWLWVLYVPPLLIVLASLFRAILLERRAKRED* |
Ga0127503_108272752 | 3300010154 | Soil | MTLLLPFAHVGHWLWALYLPPILIVVASILRTTLAERRKKEDD* |
Ga0134080_104228832 | 3300010333 | Grasslands Soil | VQMAKALLLPLAHTGHWLWVLYLPPILIVAGSIIRARLAERRENRDD* |
Ga0126377_106454151 | 3300010362 | Tropical Forest Soil | MATLVPFAPAGHWLWVLYLPPLLIVLSSILRTRTSDWRKKDDD* |
Ga0126377_106681772 | 3300010362 | Tropical Forest Soil | MAVWVPLAHAGHWLWVLYLPPILIVAGSLLRSSIKERRRGKR* |
Ga0126377_116216282 | 3300010362 | Tropical Forest Soil | MAVLVPLAHAGHWLWVLYLPPVLIVVGSLLKTTLSERRRKRGD* |
Ga0134122_102325882 | 3300010400 | Terrestrial Soil | MALLVPAAHVGHWLWALYLPPVLIVLGSIVRTSLSERRRKSDD* |
Ga0134122_109829432 | 3300010400 | Terrestrial Soil | LILPLAHIGHWLWVLYLPPVLIVIGSLLWSKLKERD* |
Ga0105246_101523622 | 3300011119 | Miscanthus Rhizosphere | MAALLPVAHVTHWLWVLYVPPILIVLASIVRSTLRERRENRKG* |
Ga0105246_119035372 | 3300011119 | Miscanthus Rhizosphere | MLPAAHVGHYLWVLYLPPILIVGASLLRTTLSERRKKRDD* |
Ga0105246_125240222 | 3300011119 | Miscanthus Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREED* |
Ga0157286_100314272 | 3300012908 | Soil | MALLVPIAHAGHWLWVLYLPPVLIVIGSLLWGKLKERD* |
Ga0157306_102358551 | 3300012912 | Soil | PLAHATHWLWVLYLPPVLIVIGAMLRVALAERRKKRD* |
Ga0157297_103286691 | 3300012914 | Soil | MAFLLPLAHAGHWLWVLYLPPLLIVLGSLLWTKLSERRKGRDDQEA* |
Ga0157310_100241412 | 3300012916 | Soil | MAVLVPLAHAGHWLWVLYLPPLLIVAGSLLRTTLSERRKKKRDD* |
Ga0137404_101349292 | 3300012929 | Vadose Zone Soil | MAHLVPFAHVGHWLWALYLPPILIVLGSIARTSLSERRKKRDD* |
Ga0164241_1000574814 | 3300012943 | Soil | MAFLLPVAHAGHWLWVLYIPPIIVVLLSIARTTYSERRNKRGD* |
Ga0164241_100319255 | 3300012943 | Soil | MALLLPVAHAGHWLWVLYIPPIVFVALSIAKTTYSERRRKRDD* |
Ga0164308_117601832 | 3300012985 | Soil | MAVLIPLAHVGHWLWALYLPPVLIVVGSLARSTLTERRKKREED* |
Ga0164306_101338072 | 3300012988 | Soil | MAVLVPVAHAGHWLWVLYLPPILIVAGSIARTSFRERRERNRDDAAAAKESR* |
Ga0164305_102698932 | 3300012989 | Soil | MAILIPLAHVGHWLWVLYLPPVLIVLGSLTRSTLAERRKKRKDD* |
Ga0157374_101841882 | 3300013296 | Miscanthus Rhizosphere | MAILVPLAHAGHWLWALYLPPILIVVGSIARTSLSERRKNRGDREV* |
Ga0157374_101979002 | 3300013296 | Miscanthus Rhizosphere | MALIVPIAHVGHWLWVLYLPPILIVAVSILRTTLRERREKDREAEAPKESR* |
Ga0157375_100207033 | 3300013308 | Miscanthus Rhizosphere | MAYLVPLAHVGHWLWALYLPPILIVLGSIARTSLSERRRKRDD* |
Ga0075313_11355372 | 3300014267 | Natural And Restored Wetlands | MPAAPLAHVSHWLWLLYLPPVLIVLASIVRSTLAERKRRREG* |
Ga0075325_10002694 | 3300014270 | Natural And Restored Wetlands | VAFLLPLAHASHWLWVLYLPPILIVAGSIIRTTLIERRKKRD* |
Ga0075325_10027103 | 3300014270 | Natural And Restored Wetlands | MLPLAHVAHWAWALYLPPVLIVLGSVLRAKLAERRDRRGPG* |
Ga0163163_106629551 | 3300014325 | Switchgrass Rhizosphere | MANLLPIAHVGHWLWVLYLPPILIVLGSIVRNTLAERRRKRGSRG |
Ga0167641_1088012 | 3300015064 | Glacier Forefield Soil | MAVLLPVAHAAHWLWVLYLPPVLIVIVSVVGSKLAERRRRR* |
Ga0167640_1013423 | 3300015067 | Glacier Forefield Soil | MAVLIPLAHVGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED* |
Ga0167645_10001018 | 3300015068 | Glacier Forefield Soil | MAVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED* |
Ga0167631_10117862 | 3300015168 | Glacier Forefield Soil | MAALIPLAHVGHWLWALYVPPVLIVVGSLARSTFAERRKKREEE* |
Ga0167631_10473212 | 3300015168 | Glacier Forefield Soil | MALLVPVAHAGHWLWALYLPPILIVLGSIARTSLSERRKKRAD* |
Ga0132258_100707214 | 3300015371 | Arabidopsis Rhizosphere | VILPLAHVGHWLWVFYLVPVLIVVGAIVKSKRAERRKKGGD* |
Ga0132255_1000696133 | 3300015374 | Arabidopsis Rhizosphere | MAALFPVAHATHWLWVLYVPPIVVVLASILKTTLRERREKREA* |
Ga0190265_101104743 | 3300018422 | Soil | MATLLPIAHVSHWLWVLYLPPVLIVLGSIVRTTLAERKRRD |
Ga0190272_100175863 | 3300018429 | Soil | MAMLLPLAHVSHWLWVLYLPPILIVLVSIARTTLIERREKRSRGSR |
Ga0066655_105249512 | 3300018431 | Grasslands Soil | MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREED |
Ga0190274_100054108 | 3300018476 | Soil | MALPLPIAHVGHWLWALYLPPILIVVGSILRTRLSERREKRDD |
Ga0190274_100361482 | 3300018476 | Soil | MLPLAHVGHWTWALYLPPILIVIGSVVRNKLAERSRGRDE |
Ga0190274_116340311 | 3300018476 | Soil | MASLLPAAHAGHWLWVLYIPPIVFVVLSIAKTTYNERRKKRDD |
Ga0193707_10439092 | 3300019881 | Soil | MAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREDD |
Ga0193707_10457231 | 3300019881 | Soil | MAVLLPVAHAGHWLWVLYLPPVLIVVGSILRTSLSERRKKDDD |
Ga0193741_10032033 | 3300019884 | Soil | VELFLPLAHVGHWLWVLYLPPILIVAGSIVRSVFVERRRRDGD |
Ga0193699_102780093 | 3300021363 | Soil | MLPVAHVGHWLWVLYLPPVLIVIGSIVRSRVLERRERRESEERTD |
Ga0210397_102717492 | 3300021403 | Soil | MAILIPLAHVGHWLWVLYLPPVLIVVGSLARSKLAERRQDRDED |
Ga0222621_11112092 | 3300021510 | Groundwater Sediment | MHDALLPLAHVGHWLWALYLPPILIVLFSIVRTTFMERRKKQDDSSAGGESPGP |
Ga0247793_10656262 | 3300023066 | Soil | MALDLPLAHTGHWLWLLYLPPILIVAGSIVRTMLEQRRHPRDEDD |
Ga0207682_100000606 | 3300025893 | Miscanthus Rhizosphere | MAALVPLAHVGHWLWALYLPPILIVIGSLLWSKLKERD |
Ga0207690_101627491 | 3300025932 | Corn Rhizosphere | MAALLPVAHATHWLWVLYVPPVLIVLVSIVRTTLRQRRANRKS |
Ga0207686_101102652 | 3300025934 | Miscanthus Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQSRKED |
Ga0207704_106031942 | 3300025938 | Miscanthus Rhizosphere | MAVLVPLAHAGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED |
Ga0207661_100147696 | 3300025944 | Corn Rhizosphere | MGVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED |
Ga0207661_113527512 | 3300025944 | Corn Rhizosphere | MADALALPLAHAGHWLWLLYVPPVLIVIGSIVRSVIAERREDRD |
Ga0207712_108503262 | 3300025961 | Switchgrass Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVAASIARSTLTERRKKREED |
Ga0207640_100484592 | 3300025981 | Corn Rhizosphere | MAALVLLAHVGHWLWVLYLPPVLIVVGSLLWSKLKERD |
Ga0207703_10000020156 | 3300026035 | Switchgrass Rhizosphere | MAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREEA |
Ga0207639_100163082 | 3300026041 | Corn Rhizosphere | MALPIPLAHVGHWLWVLYLPPVLIVIGSLARSTLAERRRKREEK |
Ga0208911_10000574 | 3300026051 | Natural And Restored Wetlands | VAFLLPLAHASHWLWVLYLPPILIVAGSIIRTTLIERRKKRD |
Ga0208911_10005753 | 3300026051 | Natural And Restored Wetlands | MLPLAHVAHWAWALYLPPVLIVLGSVLRAKLAERRDRRGPG |
Ga0207708_100291752 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFPLPLAHVTHWLWVLYLPPVLIVLASIVKTTLSERRKKRDD |
Ga0207702_101937313 | 3300026078 | Corn Rhizosphere | MAVLTPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREESRRD |
Ga0207641_100019069 | 3300026088 | Switchgrass Rhizosphere | VALLLPVAHAGHWLWVLYLPPVLIVVGSILRTTISERRKKRDD |
Ga0207675_1011946471 | 3300026118 | Switchgrass Rhizosphere | MAVLVPLAHAGHWLWVLYLPPLLLVIGSLLRTTLSERRKKRED |
Ga0207683_101172483 | 3300026121 | Miscanthus Rhizosphere | MALLVPFAHVGHWLWALYLPPVLIVLGSIARTSLSERRNKRDD |
Ga0207983_10018322 | 3300027310 | Soil | MAILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR |
Ga0208890_10202761 | 3300027523 | Soil | VALLLPLAHAGHWLWVLYLPPILIVAGSILRTKLRERRKGPED |
Ga0208998_10037712 | 3300027524 | Forest Soil | MAVLIPLAHVGHWLWALYLPPVLIVIGSLARSTLAERRKKRGKD |
Ga0256866_11325572 | 3300027650 | Soil | MIEIPLAHVGHYLWVMYIPPVLIVIGSIIRTTLVQRREERESDRGEGR |
Ga0209462_100109013 | 3300027761 | Agave | MLPLAHVGHWVWVLYLPPVLVVLASIVRTTLAERREKAENRKASP |
Ga0307282_101067612 | 3300028784 | Soil | MLEAVIVPIAHVGHWLWVLYLPPILIVIGSIVRSKALERRDKRDDRSTD |
Ga0307503_103788771 | 3300028802 | Soil | LLPLAHATHWLWVLYLPPVLIVLGSIVKATVSGRRQDRREGKS |
Ga0307496_100002463 | 3300031200 | Soil | MAVLVPLAHAGHWLWVLYLPPLLIVIGSLLRTTLSERRKKREDRRV |
Ga0299914_1000012537 | 3300031228 | Soil | MGSLLPVAHATHWLWVLYLPPILIVLASIVRSKLSERRGRRAPTEPGRPRR |
Ga0326597_103782862 | 3300031965 | Soil | MAMAVLVAHVSHWLWVLYLPPILIVLAAIVRATIAERRGKRARGSR |
Ga0370490_0026448_13_141 | 3300034128 | Untreated Peat Soil | VAIFLPLAHATHWLWVLYLPPILVVAGSILRTALVERRKKRD |
Ga0370497_0000224_5206_5340 | 3300034965 | Untreated Peat Soil | MALMVPIAHVGHWLWALYLPPVLIVVGSIARTSLSERRERKKDD |
⦗Top⦘ |