NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084381

Metagenome / Metatranscriptome Family F084381

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084381
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 44 residues
Representative Sequence MAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREED
Number of Associated Samples 95
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.43 %
% of genes near scaffold ends (potentially truncated) 9.82 %
% of genes from short scaffolds (< 2000 bps) 63.39 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.071 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.536 % of family members)
Environment Ontology (ENVO) Unclassified
(52.679 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.750 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.56%    β-sheet: 0.00%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF01458SUFBD 63.39
PF02401LYTB 2.68
PF00903Glyoxalase 2.68
PF00355Rieske 1.79
PF03717PBP_dimer 0.89
PF02782FGGY_C 0.89
PF07992Pyr_redox_2 0.89
PF12697Abhydrolase_6 0.89
PF02073Peptidase_M29 0.89
PF03449GreA_GreB_N 0.89
PF01565FAD_binding_4 0.89
PF01592NifU_N 0.89
PF01909NTP_transf_2 0.89
PF13365Trypsin_2 0.89
PF00440TetR_N 0.89
PF01883FeS_assembly_P 0.89
PF01850PIN 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 63.39
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 5.36
COG0768Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)Cell cycle control, cell division, chromosome partitioning [D] 0.89
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.89
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.89
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.07 %
UnclassifiedrootN/A8.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000858|JGI10213J12805_10092349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1694Open in IMG/M
3300001213|JGIcombinedJ13530_108637672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales520Open in IMG/M
3300002568|C688J35102_119247795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium661Open in IMG/M
3300002568|C688J35102_120913086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2262Open in IMG/M
3300003992|Ga0055470_10169971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium582Open in IMG/M
3300004071|Ga0055486_10015087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1242Open in IMG/M
3300005160|Ga0066820_1011242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1605Open in IMG/M
3300005163|Ga0066823_10157277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1507Open in IMG/M
3300005329|Ga0070683_100020936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5831Open in IMG/M
3300005332|Ga0066388_100846292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1501Open in IMG/M
3300005337|Ga0070682_100000009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales291635Open in IMG/M
3300005366|Ga0070659_100223519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300005441|Ga0070700_100130368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1696Open in IMG/M
3300005455|Ga0070663_100140924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1841Open in IMG/M
3300005539|Ga0068853_100065475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3154Open in IMG/M
3300005539|Ga0068853_100996131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300005548|Ga0070665_100000022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales379286Open in IMG/M
3300005614|Ga0068856_100276868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1694Open in IMG/M
3300005719|Ga0068861_101240735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium722Open in IMG/M
3300005841|Ga0068863_100000761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales32288Open in IMG/M
3300005874|Ga0075288_1005823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1574Open in IMG/M
3300005889|Ga0075290_1006295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1311Open in IMG/M
3300006237|Ga0097621_100649161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales968Open in IMG/M
3300006572|Ga0074051_11452158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300006578|Ga0074059_11807382Not Available1158Open in IMG/M
3300006578|Ga0074059_12120893Not Available1293Open in IMG/M
3300006642|Ga0075521_10576485Not Available553Open in IMG/M
3300006755|Ga0079222_12656426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium504Open in IMG/M
3300006846|Ga0075430_100240928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1499Open in IMG/M
3300006881|Ga0068865_100656292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300009098|Ga0105245_10000800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales28549Open in IMG/M
3300009148|Ga0105243_12845296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium524Open in IMG/M
3300009162|Ga0075423_12060555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium618Open in IMG/M
3300009176|Ga0105242_10080238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2727Open in IMG/M
3300009553|Ga0105249_10170303All Organisms → cellular organisms → Bacteria2111Open in IMG/M
3300010037|Ga0126304_10200850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1304Open in IMG/M
3300010154|Ga0127503_10827275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3172Open in IMG/M
3300010333|Ga0134080_10422883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1620Open in IMG/M
3300010362|Ga0126377_10645415Not Available1107Open in IMG/M
3300010362|Ga0126377_10668177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1089Open in IMG/M
3300010362|Ga0126377_11621628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium721Open in IMG/M
3300010400|Ga0134122_10232588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1547Open in IMG/M
3300010400|Ga0134122_10982943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia825Open in IMG/M
3300011119|Ga0105246_10152362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1751Open in IMG/M
3300011119|Ga0105246_11903537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium571Open in IMG/M
3300011119|Ga0105246_12524022Not Available506Open in IMG/M
3300012908|Ga0157286_10031427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1246Open in IMG/M
3300012912|Ga0157306_10235855Not Available636Open in IMG/M
3300012914|Ga0157297_10328669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium587Open in IMG/M
3300012916|Ga0157310_10024141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1603Open in IMG/M
3300012929|Ga0137404_10134929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2035Open in IMG/M
3300012943|Ga0164241_10005748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11481Open in IMG/M
3300012943|Ga0164241_10031925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3986Open in IMG/M
3300012985|Ga0164308_11760183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1576Open in IMG/M
3300012988|Ga0164306_10133807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1668Open in IMG/M
3300012989|Ga0164305_10269893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1240Open in IMG/M
3300013296|Ga0157374_10184188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2041Open in IMG/M
3300013296|Ga0157374_10197900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1967Open in IMG/M
3300013308|Ga0157375_10020703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6017Open in IMG/M
3300014267|Ga0075313_1135537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales626Open in IMG/M
3300014270|Ga0075325_1000269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales8534Open in IMG/M
3300014270|Ga0075325_1002710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2814Open in IMG/M
3300014325|Ga0163163_10662955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1107Open in IMG/M
3300015064|Ga0167641_108801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1209Open in IMG/M
3300015067|Ga0167640_101342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2367Open in IMG/M
3300015068|Ga0167645_100010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales35718Open in IMG/M
3300015168|Ga0167631_1011786Not Available1318Open in IMG/M
3300015168|Ga0167631_1047321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium705Open in IMG/M
3300015371|Ga0132258_10070721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8090Open in IMG/M
3300015374|Ga0132255_100069613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4670Open in IMG/M
3300018422|Ga0190265_10110474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2601Open in IMG/M
3300018429|Ga0190272_10017586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3651Open in IMG/M
3300018431|Ga0066655_10524951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1787Open in IMG/M
3300018476|Ga0190274_10005410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7669Open in IMG/M
3300018476|Ga0190274_10036148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3431Open in IMG/M
3300018476|Ga0190274_11634031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium737Open in IMG/M
3300019881|Ga0193707_1043909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1439Open in IMG/M
3300019881|Ga0193707_1045723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1404Open in IMG/M
3300019884|Ga0193741_1003203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4550Open in IMG/M
3300021363|Ga0193699_10278009Not Available698Open in IMG/M
3300021403|Ga0210397_10271749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1237Open in IMG/M
3300021510|Ga0222621_1111209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia582Open in IMG/M
3300023066|Ga0247793_1065626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales600Open in IMG/M
3300025893|Ga0207682_10000060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia46992Open in IMG/M
3300025932|Ga0207690_10162749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1665Open in IMG/M
3300025934|Ga0207686_10110265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1855Open in IMG/M
3300025938|Ga0207704_10603194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1899Open in IMG/M
3300025944|Ga0207661_10014769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5729Open in IMG/M
3300025944|Ga0207661_11352751All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025961|Ga0207712_10850326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1804Open in IMG/M
3300025981|Ga0207640_10048459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2747Open in IMG/M
3300026035|Ga0207703_10000020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales251603Open in IMG/M
3300026041|Ga0207639_10016308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5253Open in IMG/M
3300026051|Ga0208911_1000057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6716Open in IMG/M
3300026051|Ga0208911_1000575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3017Open in IMG/M
3300026075|Ga0207708_10029175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4180Open in IMG/M
3300026078|Ga0207702_10193731Not Available1880Open in IMG/M
3300026088|Ga0207641_10001906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20029Open in IMG/M
3300026118|Ga0207675_101194647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium781Open in IMG/M
3300026121|Ga0207683_10117248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2387Open in IMG/M
3300027310|Ga0207983_1001832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2243Open in IMG/M
3300027523|Ga0208890_1020276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium952Open in IMG/M
3300027524|Ga0208998_1003771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2254Open in IMG/M
3300027650|Ga0256866_1132557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia675Open in IMG/M
3300027761|Ga0209462_10010901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1460Open in IMG/M
3300028784|Ga0307282_10106761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1304Open in IMG/M
3300028802|Ga0307503_10378877Not Available733Open in IMG/M
3300031200|Ga0307496_10000246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3846Open in IMG/M
3300031228|Ga0299914_10000125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales44510Open in IMG/M
3300031965|Ga0326597_10378286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1582Open in IMG/M
3300034128|Ga0370490_0026448All Organisms → cellular organisms → Bacteria → Terrabacteria group1934Open in IMG/M
3300034965|Ga0370497_0000224All Organisms → cellular organisms → Bacteria9710Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.36%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil4.46%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.79%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015064Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015067Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015068Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027761Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10213J12805_1009234923300000858SoilMAWLLPLAHVSHWLWVLYLPPILIVALSVIGSTLRERRRKD*
JGIcombinedJ13530_10863767223300001213WetlandMLPLAHAGHYLWVLYLPPVLIVLASIIRTTLAERRERRSRGSR*
C688J35102_11924779523300002568SoilMLPLAHVGHWLWVLYLPPILIVIGSIVRSKILERRQSRDQAESQ
C688J35102_12091308623300002568SoilVQTGSNTEPMARLLPIAHAGHLLWVLYLPPILIVGASIVRTAISDRRKKRND*
Ga0055470_1016997113300003992Natural And Restored WetlandsMHESLLVPLAHAGHWLWLLYVPPILIVLGSIVRTALAERRSRREADRSSD*
Ga0055486_1001508723300004071Natural And Restored WetlandsMAVLVPLAHAGHWLWVLYLPPILVVAGSLLRSTVRERRQKKDD*
Ga0066820_101124223300005160SoilMAILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR*
Ga0066823_1015727723300005163SoilTEDMAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREED*
Ga0070683_10002093633300005329Corn RhizosphereMGVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED*
Ga0066388_10084629213300005332Tropical Forest SoilVIPVAHAGHWLWVLYLPPVAIVAFSLTRSKLNERRERKRRTD*
Ga0070682_100000009153300005337Corn RhizosphereMAVLLPLAHTGHWLWVLYLPPLLIVLGSLLRTALSERRKERND*
Ga0070659_10022351913300005366Corn RhizosphereMAALLPVAHATHWLWVLYVPPVLIVLVSIVRTTLRQRRANRKS*
Ga0070700_10013036823300005441Corn, Switchgrass And Miscanthus RhizosphereMAFPLPLAHVTHWLWVLYLPPVLIVLASIVKTTLSERRKKRDD*
Ga0070663_10014092423300005455Corn RhizosphereMVPVAHVGHWLWALYLPPVLIVVGSIARTSLSERREKKKGD*
Ga0068853_10006547533300005539Corn RhizosphereMALPIPLAHVGHWLWVLYLPPVLIVIGSLARSTLAERRRKREEK*
Ga0068853_10099613123300005539Corn RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQDRDED*
Ga0070665_1000000221033300005548Switchgrass RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREEA*
Ga0068856_10027686833300005614Corn RhizosphereMAVLTPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREESRRD*
Ga0068861_10124073523300005719Switchgrass RhizosphereMAVLVPLAHAGHWLWVLYLPPLLLVIGSLLRTTLSERRKKRED*
Ga0068863_100000761193300005841Switchgrass RhizosphereVALLLPVAHAGHWLWVLYLPPVLIVVGSILRTTISERRKKRDD*
Ga0075288_100582323300005874Rice Paddy SoilMALLLPAAHAGHWLWVLYVPPVLIVAGSILRTKLRERRKGPQS*
Ga0075290_100629523300005889Rice Paddy SoilMALLLPAAHSGHWLWVLYVPPVLIVAGSILRTKLRERRKGPQS*
Ga0097621_10064916123300006237Miscanthus RhizosphereMALLVPAAHVGHWLWALYLPPVLIVLGSIARTSLAERRRKRRD*
Ga0074051_1145215823300006572SoilVALLLPFAHTGHWLWVLYLPPILIVAGSILRTKLRERRKGPED*
Ga0074059_1180738213300006578SoilILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR*
Ga0074059_1212089323300006578SoilMAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREED*
Ga0075521_1057648523300006642Arctic Peat SoilMLTRVVIVLPVAHVGHYLWALYLPPVLIVIGSIVRAKVLERREKRDKD*
Ga0079222_1265642623300006755Agricultural SoilMAVLVPLAHAGHWLWILYLPPVLIVVVSLARSTLAERRKK
Ga0075430_10024092823300006846Populus RhizosphereVALFLPLAHATHWLWVLYLPPILIVAGSILRTTLVERRKKRD*
Ga0068865_10065629223300006881Miscanthus RhizosphereMAVLVPLAHAGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED*
Ga0105245_1000080033300009098Miscanthus RhizosphereMAVLTPLAHVGHWLWALYLPPVLIVVGSLARTTFVERRKKREED*
Ga0105243_1284529613300009148Miscanthus RhizosphereMALLVPVAHVGHWLWALYLPPILIVGVSLLRTTLLERRRKHADPHAGGT
Ga0075423_1206055523300009162Populus RhizosphereMATLVPLAHVGHWLWLLYVPPVLLVFASIVRTTLAERGRKRSRDSR*
Ga0105242_1008023823300009176Miscanthus RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQSRKED*
Ga0105249_1017030333300009553Switchgrass RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVAASIARSTLTERRKKREED*
Ga0126304_1020085023300010037Serpentine SoilMATLLPLAHTGHWLWVLYVPPLLIVLASLFRAILLERRAKRED*
Ga0127503_1082727523300010154SoilMTLLLPFAHVGHWLWALYLPPILIVVASILRTTLAERRKKEDD*
Ga0134080_1042288323300010333Grasslands SoilVQMAKALLLPLAHTGHWLWVLYLPPILIVAGSIIRARLAERRENRDD*
Ga0126377_1064541513300010362Tropical Forest SoilMATLVPFAPAGHWLWVLYLPPLLIVLSSILRTRTSDWRKKDDD*
Ga0126377_1066817723300010362Tropical Forest SoilMAVWVPLAHAGHWLWVLYLPPILIVAGSLLRSSIKERRRGKR*
Ga0126377_1162162823300010362Tropical Forest SoilMAVLVPLAHAGHWLWVLYLPPVLIVVGSLLKTTLSERRRKRGD*
Ga0134122_1023258823300010400Terrestrial SoilMALLVPAAHVGHWLWALYLPPVLIVLGSIVRTSLSERRRKSDD*
Ga0134122_1098294323300010400Terrestrial SoilLILPLAHIGHWLWVLYLPPVLIVIGSLLWSKLKERD*
Ga0105246_1015236223300011119Miscanthus RhizosphereMAALLPVAHVTHWLWVLYVPPILIVLASIVRSTLRERRENRKG*
Ga0105246_1190353723300011119Miscanthus RhizosphereMLPAAHVGHYLWVLYLPPILIVGASLLRTTLSERRKKRDD*
Ga0105246_1252402223300011119Miscanthus RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREED*
Ga0157286_1003142723300012908SoilMALLVPIAHAGHWLWVLYLPPVLIVIGSLLWGKLKERD*
Ga0157306_1023585513300012912SoilPLAHATHWLWVLYLPPVLIVIGAMLRVALAERRKKRD*
Ga0157297_1032866913300012914SoilMAFLLPLAHAGHWLWVLYLPPLLIVLGSLLWTKLSERRKGRDDQEA*
Ga0157310_1002414123300012916SoilMAVLVPLAHAGHWLWVLYLPPLLIVAGSLLRTTLSERRKKKRDD*
Ga0137404_1013492923300012929Vadose Zone SoilMAHLVPFAHVGHWLWALYLPPILIVLGSIARTSLSERRKKRDD*
Ga0164241_10005748143300012943SoilMAFLLPVAHAGHWLWVLYIPPIIVVLLSIARTTYSERRNKRGD*
Ga0164241_1003192553300012943SoilMALLLPVAHAGHWLWVLYIPPIVFVALSIAKTTYSERRRKRDD*
Ga0164308_1176018323300012985SoilMAVLIPLAHVGHWLWALYLPPVLIVVGSLARSTLTERRKKREED*
Ga0164306_1013380723300012988SoilMAVLVPVAHAGHWLWVLYLPPILIVAGSIARTSFRERRERNRDDAAAAKESR*
Ga0164305_1026989323300012989SoilMAILIPLAHVGHWLWVLYLPPVLIVLGSLTRSTLAERRKKRKDD*
Ga0157374_1018418823300013296Miscanthus RhizosphereMAILVPLAHAGHWLWALYLPPILIVVGSIARTSLSERRKNRGDREV*
Ga0157374_1019790023300013296Miscanthus RhizosphereMALIVPIAHVGHWLWVLYLPPILIVAVSILRTTLRERREKDREAEAPKESR*
Ga0157375_1002070333300013308Miscanthus RhizosphereMAYLVPLAHVGHWLWALYLPPILIVLGSIARTSLSERRRKRDD*
Ga0075313_113553723300014267Natural And Restored WetlandsMPAAPLAHVSHWLWLLYLPPVLIVLASIVRSTLAERKRRREG*
Ga0075325_100026943300014270Natural And Restored WetlandsVAFLLPLAHASHWLWVLYLPPILIVAGSIIRTTLIERRKKRD*
Ga0075325_100271033300014270Natural And Restored WetlandsMLPLAHVAHWAWALYLPPVLIVLGSVLRAKLAERRDRRGPG*
Ga0163163_1066295513300014325Switchgrass RhizosphereMANLLPIAHVGHWLWVLYLPPILIVLGSIVRNTLAERRRKRGSRG
Ga0167641_10880123300015064Glacier Forefield SoilMAVLLPVAHAAHWLWVLYLPPVLIVIVSVVGSKLAERRRRR*
Ga0167640_10134233300015067Glacier Forefield SoilMAVLIPLAHVGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED*
Ga0167645_100010183300015068Glacier Forefield SoilMAVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED*
Ga0167631_101178623300015168Glacier Forefield SoilMAALIPLAHVGHWLWALYVPPVLIVVGSLARSTFAERRKKREEE*
Ga0167631_104732123300015168Glacier Forefield SoilMALLVPVAHAGHWLWALYLPPILIVLGSIARTSLSERRKKRAD*
Ga0132258_1007072143300015371Arabidopsis RhizosphereVILPLAHVGHWLWVFYLVPVLIVVGAIVKSKRAERRKKGGD*
Ga0132255_10006961333300015374Arabidopsis RhizosphereMAALFPVAHATHWLWVLYVPPIVVVLASILKTTLRERREKREA*
Ga0190265_1011047433300018422SoilMATLLPIAHVSHWLWVLYLPPVLIVLGSIVRTTLAERKRRD
Ga0190272_1001758633300018429SoilMAMLLPLAHVSHWLWVLYLPPILIVLVSIARTTLIERREKRSRGSR
Ga0066655_1052495123300018431Grasslands SoilMAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREED
Ga0190274_1000541083300018476SoilMALPLPIAHVGHWLWALYLPPILIVVGSILRTRLSERREKRDD
Ga0190274_1003614823300018476SoilMLPLAHVGHWTWALYLPPILIVIGSVVRNKLAERSRGRDE
Ga0190274_1163403113300018476SoilMASLLPAAHAGHWLWVLYIPPIVFVVLSIAKTTYNERRKKRDD
Ga0193707_104390923300019881SoilMAVLIPLAHVGHWLWVLYLPPVLIVVGSLARSTLAERRKKREDD
Ga0193707_104572313300019881SoilMAVLLPVAHAGHWLWVLYLPPVLIVVGSILRTSLSERRKKDDD
Ga0193741_100320333300019884SoilVELFLPLAHVGHWLWVLYLPPILIVAGSIVRSVFVERRRRDGD
Ga0193699_1027800933300021363SoilMLPVAHVGHWLWVLYLPPVLIVIGSIVRSRVLERRERRESEERTD
Ga0210397_1027174923300021403SoilMAILIPLAHVGHWLWVLYLPPVLIVVGSLARSKLAERRQDRDED
Ga0222621_111120923300021510Groundwater SedimentMHDALLPLAHVGHWLWALYLPPILIVLFSIVRTTFMERRKKQDDSSAGGESPGP
Ga0247793_106562623300023066SoilMALDLPLAHTGHWLWLLYLPPILIVAGSIVRTMLEQRRHPRDEDD
Ga0207682_1000006063300025893Miscanthus RhizosphereMAALVPLAHVGHWLWALYLPPILIVIGSLLWSKLKERD
Ga0207690_1016274913300025932Corn RhizosphereMAALLPVAHATHWLWVLYVPPVLIVLVSIVRTTLRQRRANRKS
Ga0207686_1011026523300025934Miscanthus RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVLGSLARSKLAERRQSRKED
Ga0207704_1060319423300025938Miscanthus RhizosphereMAVLVPLAHAGHWLWVLYLPPVLIVVVSLARSTLAERRKKREED
Ga0207661_1001476963300025944Corn RhizosphereMGVLIPLAHVGHWLWVLYLPPVLIVVGSLTRSTLAERRKKREED
Ga0207661_1135275123300025944Corn RhizosphereMADALALPLAHAGHWLWLLYVPPVLIVIGSIVRSVIAERREDRD
Ga0207712_1085032623300025961Switchgrass RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVAASIARSTLTERRKKREED
Ga0207640_1004845923300025981Corn RhizosphereMAALVLLAHVGHWLWVLYLPPVLIVVGSLLWSKLKERD
Ga0207703_100000201563300026035Switchgrass RhizosphereMAVLIPLAHVGHWLWVLYLPPVLIVAGSLARSTLAERRKKREEA
Ga0207639_1001630823300026041Corn RhizosphereMALPIPLAHVGHWLWVLYLPPVLIVIGSLARSTLAERRRKREEK
Ga0208911_100005743300026051Natural And Restored WetlandsVAFLLPLAHASHWLWVLYLPPILIVAGSIIRTTLIERRKKRD
Ga0208911_100057533300026051Natural And Restored WetlandsMLPLAHVAHWAWALYLPPVLIVLGSVLRAKLAERRDRRGPG
Ga0207708_1002917523300026075Corn, Switchgrass And Miscanthus RhizosphereMAFPLPLAHVTHWLWVLYLPPVLIVLASIVKTTLSERRKKRDD
Ga0207702_1019373133300026078Corn RhizosphereMAVLTPLAHVGHWLWVLYLPPVLIVLGSLARSTLAERRKKREESRRD
Ga0207641_1000190693300026088Switchgrass RhizosphereVALLLPVAHAGHWLWVLYLPPVLIVVGSILRTTISERRKKRDD
Ga0207675_10119464713300026118Switchgrass RhizosphereMAVLVPLAHAGHWLWVLYLPPLLLVIGSLLRTTLSERRKKRED
Ga0207683_1011724833300026121Miscanthus RhizosphereMALLVPFAHVGHWLWALYLPPVLIVLGSIARTSLSERRNKRDD
Ga0207983_100183223300027310SoilMAILLPIAHVGHWLWALYLPPILIVLGSIVRTTVSERRKKRDGGSRGSR
Ga0208890_102027613300027523SoilVALLLPLAHAGHWLWVLYLPPILIVAGSILRTKLRERRKGPED
Ga0208998_100377123300027524Forest SoilMAVLIPLAHVGHWLWALYLPPVLIVIGSLARSTLAERRKKRGKD
Ga0256866_113255723300027650SoilMIEIPLAHVGHYLWVMYIPPVLIVIGSIIRTTLVQRREERESDRGEGR
Ga0209462_1001090133300027761AgaveMLPLAHVGHWVWVLYLPPVLVVLASIVRTTLAERREKAENRKASP
Ga0307282_1010676123300028784SoilMLEAVIVPIAHVGHWLWVLYLPPILIVIGSIVRSKALERRDKRDDRSTD
Ga0307503_1037887713300028802SoilLLPLAHATHWLWVLYLPPVLIVLGSIVKATVSGRRQDRREGKS
Ga0307496_1000024633300031200SoilMAVLVPLAHAGHWLWVLYLPPLLIVIGSLLRTTLSERRKKREDRRV
Ga0299914_10000125373300031228SoilMGSLLPVAHATHWLWVLYLPPILIVLASIVRSKLSERRGRRAPTEPGRPRR
Ga0326597_1037828623300031965SoilMAMAVLVAHVSHWLWVLYLPPILIVLAAIVRATIAERRGKRARGSR
Ga0370490_0026448_13_1413300034128Untreated Peat SoilVAIFLPLAHATHWLWVLYLPPILVVAGSILRTALVERRKKRD
Ga0370497_0000224_5206_53403300034965Untreated Peat SoilMALMVPIAHVGHWLWALYLPPVLIVVGSIARTSLSERRERKKDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.