NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084325

Metagenome / Metatranscriptome Family F084325

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084325
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 47 residues
Representative Sequence AVGALWWLLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY
Number of Associated Samples 104
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.43 %
% of genes from short scaffolds (< 2000 bps) 91.07 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.679 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(23.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.750 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.58%    β-sheet: 0.00%    Coil/Unstructured: 53.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00364Biotin_lipoyl 37.50
PF00378ECH_1 16.07
PF09990DUF2231 14.29
PF04542Sigma70_r2 10.71
PF01370Epimerase 5.36
PF08281Sigma70_r4_2 4.46
PF00486Trans_reg_C 1.79
PF13533Biotin_lipoyl_2 1.79
PF13490zf-HC2 0.89
PF02518HATPase_c 0.89
PF04545Sigma70_r4 0.89
PF04185Phosphoesterase 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 10.71
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 10.71
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 10.71
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 10.71
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.68 %
UnclassifiedrootN/A22.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_125535545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300002568|C688J35102_119078147Not Available635Open in IMG/M
3300002568|C688J35102_120283227All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300004153|Ga0063455_100233076All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300005161|Ga0066807_1010779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300005187|Ga0066675_10253358All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300005367|Ga0070667_101355483All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005437|Ga0070710_11413599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300005457|Ga0070662_101186571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300005468|Ga0070707_100849756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300005518|Ga0070699_101014851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300005617|Ga0068859_102743402Not Available541Open in IMG/M
3300005764|Ga0066903_108836829Not Available511Open in IMG/M
3300005841|Ga0068863_102298723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300005937|Ga0081455_10758069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300006049|Ga0075417_10519549All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006052|Ga0075029_100459450All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300006353|Ga0075370_10949828Not Available526Open in IMG/M
3300006642|Ga0075521_10664244Not Available514Open in IMG/M
3300006845|Ga0075421_100261404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2118Open in IMG/M
3300006845|Ga0075421_101131023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium878Open in IMG/M
3300006846|Ga0075430_100219817All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300006846|Ga0075430_100233632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1524Open in IMG/M
3300006846|Ga0075430_100479157All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300006853|Ga0075420_100313007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300006880|Ga0075429_100554742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1007Open in IMG/M
3300006969|Ga0075419_10703716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300009094|Ga0111539_11149140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300009098|Ga0105245_12634437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300009143|Ga0099792_10539531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300009147|Ga0114129_13070975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300009176|Ga0105242_10856402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300009525|Ga0116220_10468595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300009527|Ga0114942_1174808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300009553|Ga0105249_12164702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300009789|Ga0126307_11334297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300009870|Ga0131092_10907836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300009873|Ga0131077_10663883Not Available932Open in IMG/M
3300010038|Ga0126315_10748031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300010041|Ga0126312_10339343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300010379|Ga0136449_100274956Not Available3100Open in IMG/M
3300010379|Ga0136449_100925456Not Available1416Open in IMG/M
3300010938|Ga0137716_10198976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300012199|Ga0137383_10545784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300012203|Ga0137399_10491855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300012209|Ga0137379_10469504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1167Open in IMG/M
3300012211|Ga0137377_11490565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia603Open in IMG/M
3300012350|Ga0137372_10593466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300012357|Ga0137384_10749625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300012906|Ga0157295_10377417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300012951|Ga0164300_11172702Not Available507Open in IMG/M
3300012958|Ga0164299_11511015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300012971|Ga0126369_10062923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3222Open in IMG/M
3300013296|Ga0157374_12350913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300013308|Ga0157375_12855588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300014326|Ga0157380_13100464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300014501|Ga0182024_10069340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC262565355Open in IMG/M
3300015372|Ga0132256_102136469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300015372|Ga0132256_103677463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300018072|Ga0184635_10375131Not Available542Open in IMG/M
3300018422|Ga0190265_11287081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium848Open in IMG/M
3300020220|Ga0194119_10440505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300021403|Ga0210397_10557146Not Available873Open in IMG/M
3300022557|Ga0212123_10017630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC262568528Open in IMG/M
3300025326|Ga0209342_11267860Not Available537Open in IMG/M
3300025732|Ga0208784_1133131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300025910|Ga0207684_10025608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5028Open in IMG/M
3300025923|Ga0207681_11140324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300025927|Ga0207687_11789453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300025937|Ga0207669_11022660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300025941|Ga0207711_11605970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300026035|Ga0207703_11337808Not Available689Open in IMG/M
3300026075|Ga0207708_11167757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300026121|Ga0207683_11865307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300026142|Ga0207698_11742134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300026552|Ga0209577_10716772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300027603|Ga0209331_1162953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300027880|Ga0209481_10149922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1151Open in IMG/M
3300027909|Ga0209382_10862638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium957Open in IMG/M
3300029984|Ga0311332_11023890Not Available663Open in IMG/M
3300030000|Ga0311337_11731897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300030002|Ga0311350_11068542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300030019|Ga0311348_11371053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300030620|Ga0302046_11286370Not Available572Open in IMG/M
3300031058|Ga0308189_10095728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300031091|Ga0308201_10355335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300031251|Ga0265327_10270750All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031561|Ga0318528_10249911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes951Open in IMG/M
3300031681|Ga0318572_10672893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300031771|Ga0318546_10595554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales777Open in IMG/M
3300031771|Ga0318546_10696441Not Available715Open in IMG/M
3300031779|Ga0318566_10275247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256834Open in IMG/M
3300031781|Ga0318547_10405649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes837Open in IMG/M
3300031902|Ga0302322_100144607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2538Open in IMG/M
3300031918|Ga0311367_10801560Not Available953Open in IMG/M
3300031954|Ga0306926_12875134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031997|Ga0315278_10337262Not Available1558Open in IMG/M
3300031997|Ga0315278_11244752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300031999|Ga0315274_10884065Not Available933Open in IMG/M
3300032053|Ga0315284_10954918Not Available972Open in IMG/M
3300032059|Ga0318533_11112217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300032075|Ga0310890_11002287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300032076|Ga0306924_12027529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300032156|Ga0315295_10965708Not Available847Open in IMG/M
3300032174|Ga0307470_11864825Not Available511Open in IMG/M
3300032177|Ga0315276_10306971Not Available1687Open in IMG/M
3300032397|Ga0315287_10185325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2422Open in IMG/M
3300033550|Ga0247829_10741263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300033807|Ga0314866_100718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300033978|Ga0334977_0349215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.14%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.25%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.46%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.89%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.89%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.89%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.89%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.89%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_12553554513300000956SoilALVGGAWWFLFHRYKKWYVWIAGAIPFLVVLFVFYTYLERLLPSNY*
C688J35102_11907814713300002568SoilAVGLLWWLVFHRYHRWTTWIAGAIPFALVLFFFYFHLERVLPSNY*
C688J35102_12028322713300002568SoilILWGTIALAVGLLWWLLFHRHPRWTTWFVGVVPFLIVLFVAYTYLERLLPSNY*
Ga0063455_10023307633300004153SoilIGLLWWLLFHRHPRWTTWFLGVVPFLAALFVCYVYLERLLPSNY*
Ga0066807_101077923300005161SoilESRTPVFIAGLIAALVGGLWWLVFHRYPRWTTWFAGVIPFLVALFVFYTYLERVLPNNY*
Ga0066675_1025335843300005187SoilVGGLWWLFFHRYPRWTTWLAGVIPFLAALFVFYTFLERVLPNNY*
Ga0070667_10135548333300005367Switchgrass RhizosphereWWLLFHRHPRWTTWLVGAVPFLAALFVCYTYLERLLPSNY*
Ga0070710_1141359913300005437Corn, Switchgrass And Miscanthus RhizosphereIGLLWWLLFHRHPRWTTWFVGVVPFLAALFVCYVYVERLPPSNY*
Ga0070662_10118657123300005457Corn RhizosphereLLWWLLFHRHPRWTTWFIGVIPYAVTLAIFYFYLERALPANY*
Ga0070707_10084975623300005468Corn, Switchgrass And Miscanthus RhizosphereSESRTPVLIWGLIAAAVGALWWLLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY
Ga0070699_10101485123300005518Corn, Switchgrass And Miscanthus RhizosphereGESRAPVLIAGLIAALVGGLWWLLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY
Ga0068859_10274340233300005617Switchgrass RhizosphereFHRYPRWTTWFVGVVPFLIVLFVFYTYLERMLPSNY*
Ga0066903_10883682923300005764Tropical Forest SoilFHRYHRWTTWLMGGIPFAIVLFVFYYHLERLLPANY*
Ga0068863_10229872313300005841Switchgrass RhizosphereVIGLLWWWLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY*
Ga0081455_1075806913300005937Tabebuia Heterophylla RhizosphereIIWGVVAAVIGLLWWLLFHRHPRWTTWFIGIVPFLAALFVCYVYLERLLPSNY*
Ga0075417_1051954913300006049Populus RhizosphereVFVAGLIAALVGGLWWLVFHRYPRWTTWFAGVIPFLVALFVFYTYFERVLPNNY*
Ga0075029_10045945013300006052WatershedsRYPRWTTWIIGAVPFLAALFVFYVYLERLLPSNY*
Ga0075370_1094982823300006353Populus EndosphereLLWWLWFHRHPRWTTWFSGLIPFAVALTVFYFFLERVLPNNY*
Ga0075521_1066424423300006642Arctic Peat SoilWLIFHRYHRWTTWFMGAIPFLVVLFLFYYHLERLLPANY*
Ga0075421_10026140453300006845Populus RhizosphereVFVAGLIAAIVGGLWWLVFHRYPRWTTWFAGVIPFLVALFVFYSYLERVLPNNY*
Ga0075421_10113102313300006845Populus RhizosphereLTGLLMLLVGLLWWLLFHRHPRWTTWFIGVIPFAVTLAIFYFYLERALPANY*
Ga0075430_10021981733300006846Populus RhizosphereLYFHRHPRWTTWLIGAVPFAVSLFVFYVFLERVLPANY*
Ga0075430_10023363213300006846Populus RhizosphereLWWLVFHRYPRWTTWFAGVIPFLLALFVFYTYLERVLPNNY*
Ga0075430_10047915713300006846Populus RhizosphereFHRYPRWTTWFAGVIPFLVALFVFYTYFERVLPNNY*
Ga0075431_10194727723300006847Populus RhizosphereSRTPTILTGLLMLLVGLLWWLLFHRHPRWTTWFIGVIPFAVTLAIFYFYLERALPANY*
Ga0075420_10031300743300006853Populus RhizosphereVGGLWWLVFHRYPRWTTWFAGVIPFLIALFVFYTYLERVLPNNY*
Ga0075429_10055474213300006880Populus RhizosphereGGLWWLVFHRYPRWTTGFAGVIPFLVALFVFYSYLERVLPNNY*
Ga0075419_1070371623300006969Populus RhizosphereVGGLWWLVFHRYPRWTTWFAGVIPFLLALFVFYTYLERVLPNNY*
Ga0111539_1114914023300009094Populus RhizosphereLVGLLWWWLFHRHPRWTTWFIGVIPFAITLAIFYFYLERALPANY*
Ga0105245_1263443733300009098Miscanthus RhizosphereVGLLWWLLFHRHPRWTTWMIGVIPFLVVLFVAYTYLERLLPSNY*
Ga0099792_1053953123300009143Vadose Zone SoilLLFHRYPRWTTWFAGVIPFLVVLFDFYTYLERVLPNNY*
Ga0114129_1307097523300009147Populus RhizosphereTPAYLWGFIAAAVGGLWWLVFHRYPRWTTWFGGAIPFLIVLFFFYTYLERVLPNNY*
Ga0105242_1085640213300009176Miscanthus RhizosphereILWGIVAAVIGLLWWLLFHRHPRWTTWFAGVVPFLAALFVCYVYVERLLPSNY*
Ga0116220_1046859523300009525Peatlands SoilWWLLFHRHPRWTNWLIGVIPFLAALYFFFEYLQRVLPANY*
Ga0114942_117480823300009527GroundwaterMVIAGLVMAVIGGLWWLFFHRHPRWTTWFIGVIPFAIALLVFYYLLERTLPNY*
Ga0105249_1216470213300009553Switchgrass RhizosphereLAIGLLWWLLFHRHPRWTTWLVGVLPFLAALFVAYTYLERLLPSNY*
Ga0126307_1133429723300009789Serpentine SoilAALVGGLWWPLCHHYPRWTTWFPGVIPFLRTLFVFYTYLERFLPNNY*
Ga0131092_1090783633300009870Activated SludgeLWWLLFHRHPRWTTWFIGVVPFFITLFVTYTYLERLLPSNY*
Ga0131077_1066388313300009873WastewaterVGAAWWLVFHRYHRWTTWIVGAIPFTLVLFFFFFHLERVLPSNY*
Ga0126315_1074803113300010038Serpentine SoilHRHPSWVTWIVGAIPFVVVLFVFYTFLERVLPANY*
Ga0126312_1033934313300010041Serpentine SoilLLWWLLFHRHPRWTTWLVGAIPFFAALFVAYTYLERLLPSNY*
Ga0136449_10027495613300010379Peatlands SoilVGGLWWLAYHRHARYTTWIIGAIPFLVTLFFFYTYLERLLPANY*
Ga0136449_10092545643300010379Peatlands SoilGSLLPAVLSGLIVAVIGGLWWLGFHRHPRWTNWLIGVVPFLVALFFFFTYLERVLPSNY*
Ga0137716_1019897633300010938Hot Spring Fe-Si SedimentTLWWLVFHRHRRWTTWFLGAMPFAVVLFFFYLHLERVLPANY*
Ga0137383_1054578423300012199Vadose Zone SoilAAAGGALWWFLFHRYPRWTTWLAGVIPFLVVLFVFYTYLERVLPNNY*
Ga0137399_1049185513300012203Vadose Zone SoilAVGALWWLLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY*
Ga0137379_1046950413300012209Vadose Zone SoilAAGGALWWFLFHRYPRWTTWLAGVIPFLVVLFVFYTYLERVLPNNY*
Ga0137377_1149056513300012211Vadose Zone SoilLIAGLIAAAVGALWWLLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY*
Ga0137372_1059346613300012350Vadose Zone SoilPVFVSGLIAALVGGLWWLLFHRYSRWTSWFAGVVPFLIALFVFYTYLERVLPNNY*
Ga0137384_1074962523300012357Vadose Zone SoilWGLIAAAVGALWWFLFHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY*
Ga0157295_1037741733300012906SoilAIGLLWWLLFHRHPRWTTWLVGVIPFLAALFVAYTYLERLLPSNY*
Ga0164300_1117270213300012951SoilGALWWLVFHRYHRWTTWFMGAIPFAVVLVVFYYHLERLLPANY*
Ga0164299_1151101533300012958SoilITLVIGLLWWLLFHRHPRWTTWLVGVLPFLAALFVAYTYLERLLPSNY*
Ga0126369_1006292313300012971Tropical Forest SoilRLPVYAAALIAALVGGLWWLAFHRYPRWTTWLAGVLPFLIALFVFYTYLERVLPNNY*
Ga0157374_1235091313300013296Miscanthus RhizosphereTLIWGTITLVIGLLWWLLFHRHPRWTTWLVGVLPFLAALFVAYTYLERLLPSNY*
Ga0157375_1285558833300013308Miscanthus RhizosphereWGTITLVIGLLWWLLFHRHPRWTTWLVGVLPFLAALFVAYTYLERLLPSNY*
Ga0157380_1310046413300014326Switchgrass RhizosphereWGAIALVIGLLWWWLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY*
Ga0182024_1006934073300014501PermafrostLAYHRHARFTTWIIGAIPFLVTLFFFYTYLERLLPANY*
Ga0132256_10213646923300015372Arabidopsis RhizosphereLLMVVVGLLWWFLFHRHPRWTTWFIGVIPYAVTLAIFYFYLERALPANY*
Ga0132256_10367746323300015372Arabidopsis RhizosphereTLLAGLLMLLVGLLWWLLFHRHPRWTTWFIGVIPYAVTLAIFYFYLERALPANY*
Ga0132255_10267191213300015374Arabidopsis RhizosphereKTPMLLAALLMLLVGLLWWLLFHRHPRWTTWFIGAVPFAITLAIFYFYLERALPANY*
Ga0184635_1037513113300018072Groundwater SedimentHRHPRWTTWLVGVIPFLLALFVFYTYLERLLPSNY
Ga0190265_1128708123300018422SoilLLWWLVYHRHPRWTNWIVGAIPFAVALFFFYSFLERVLPANY
Ga0194119_1044050533300020220Freshwater LakeVVALIGGLWWLIFHRHPSLTNWLIGVLPFGAALFVFYALLERVLPSNY
Ga0210397_1055714613300021403SoilFPTVITGLIAAAVGGLWWLLFHRHPRWTNWLIGVIPFLVALYFFFEYLGRLLPANY
Ga0212123_1001763013300022557Iron-Sulfur Acid SpringFVGALWWLAFHRHPRWTNWVAGAIPFAVTLFFFYSYLERVLPANY
Ga0209342_1126786023300025326SoilIVGAIGLLWWLMFHRHPSAMNWMIGAVPFAVALLVFYALLERVLPSNY
Ga0208784_113313123300025732AqueousAGIILAVIGGLWWLLFHRHPRWTTWFIGVIPFAIALSAFYYLLERALPANY
Ga0207684_1002560813300025910Corn, Switchgrass And Miscanthus RhizospherePLPPLPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY
Ga0207681_1114032433300025923Switchgrass RhizosphereLALVGSLWWLVFHRHPRWTTWLVGAVPFLAALFVCYTYLERLLPSNY
Ga0207687_1178945333300025927Miscanthus RhizosphereLWWLLFHRHPRWTTWFVGAIPFLVVLFVAYTYLERLLPSNY
Ga0207669_1102266013300025937Miscanthus RhizosphereLLMLLVGLLWWLLFHRHPRWTTWFIGVIPYAVTLAIFYFYLERALPANY
Ga0207711_1160597013300025941Switchgrass RhizosphereTIVLAVGLLWWLLFHRHPRWTTWFIGVVPFLVVLFVAYTYLERLLPSNY
Ga0207703_1133780833300026035Switchgrass RhizosphereWWLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY
Ga0207708_1116775713300026075Corn, Switchgrass And Miscanthus RhizosphereIAALVGGAWWFLFHRYKKWYVWIAGAIPFVIVLFVFYTYLERLLPSNY
Ga0207683_1186530713300026121Miscanthus RhizosphereVPTIIWGAIALVIGLLWWWLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY
Ga0207698_1174213413300026142Corn RhizosphereVIGLLWWWLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY
Ga0209577_1071677213300026552SoilHRYPRWTTWFAGVIPFLVVLFVFYTYLERVLPNNY
Ga0209331_116295323300027603Forest SoilESRLLTLWWGLVAAAVGAAWWLLFHRHPRWTTWFVGVAPFLLVMFVFYSHLDRLLPANY
Ga0209481_1014992213300027880Populus RhizosphereLIAALVGGLWWLVFHRYPRWTTWFAGVIPFLLALFVFYTYLERVLPNNY
Ga0209382_1086263813300027909Populus RhizosphereTILTGLLMLLVGLLWWLLFHRHPRWTTWFIGVIPFAVTLAIFYFYLERALPANY
Ga0311332_1102389013300029984FenWLLFHRHPRWTTWFVGAIPFLAALFVAYTYLERLLPSNY
Ga0311337_1173189713300030000FenIGGLWWLLFHRHPRWTTWFIGVIPFAIALVVFYYLLERTLPNY
Ga0311350_1106854213300030002FenWWLLFHRHPRWTTWFLGVVPFAISLSVFDYLLERVLPSNY
Ga0311348_1137105323300030019FenTVLAGLLTALIGALWWLLFHRHPRWTTWFLGVVPFAVSLSVFYYLLERVLPSNY
Ga0302046_1128637013300030620SoilFLAAFVGALWWLVFHRYHRWTTWFVGAIPFAVALFLFYYHLERLLPANY
Ga0308189_1009572823300031058SoilLWWLLFHRYARWTTWFAGVIPFLVALFVFYTYLERVLPNNY
Ga0308201_1035533513300031091SoilAIVGGLWWLLFHRYPRWTTWFAGVIPFLVALFVFYTYLERVLPNNY
Ga0265327_1027075013300031251RhizosphereTIIWAVIVAIIGLLWWLAFHRHPRWPTWIVGAVPFLVALFFCYSYLERLLPSNY
Ga0318528_1024991113300031561SoilVLWGAIAALVGALWWLVFHRHPSWVTWIVGAVPFLVVLFVFYTYFERVLPANY
Ga0318572_1067289313300031681SoilALWWLVFHRHPSWVTWIVGAVPFLVVLFVFYTYFERVLPANY
Ga0318546_1059555433300031771SoilVFHRHPSWVTWIVGAVPFLVVLFVFYTYFERVLPANY
Ga0318546_1069644123300031771SoilWWLAFHRHPRWTNWLAGAIPFAVTLFIFYTYLERALPANY
Ga0318566_1027524733300031779SoilLIWGSIALAVGLLWWLLFHRHPRWTTWFVGVVPFLAALFVCYVYVERLLPSNY
Ga0318547_1040564913300031781SoilVGALWWLVFHRHPSWVTWIVGAVPFLVVLFVFYTYFERVLPANY
Ga0302322_10014460713300031902FenLLTALIGALWWLLFHRHPRWTTWFLGVVPFAVSLSVFYYLLERVLPSNY
Ga0311367_1080156023300031918FenLWWLLFHRHPRWTTWFLGVVPFAISLSVFYYLLERVLPSNY
Ga0306926_1287513423300031954SoilLTGLVVAAVGGLWWLGFHRYPRWTNWVIGAIPFLVALYFFYMYLSRVLPANY
Ga0315278_1033726213300031997SedimentHRHPRWTTWIIGTIPFALALFVFYSFLERVLPANY
Ga0315278_1124475233300031997SedimentHRHPRWTTWIIGAIPFGIALFVFYSFLERVLPANY
Ga0315274_1088406513300031999SedimentLWWLFFHRHPRWTTWIIGAIPFSLALFVFYSFLERVLPANY
Ga0315284_1095491823300032053SedimentGALWWLFFHRHPRWTTWIIGAIPFALALFVFYSFLERVLPANY
Ga0318533_1111221733300032059SoilLWWLLFHRHPRWTTWFVGVVPFLAALFVCYVYVERLLPSNY
Ga0310890_1100228723300032075SoilLLMLLVGLLWWLLFHRHPRWTTWFIGVIPFAVTLAIFYFYLERALPANY
Ga0306924_1202752913300032076SoilQTPAVLWGAIAALVGALWWLVFHRHPSWVTWIVGAVPFLVVLFVFYTYFERVLPANY
Ga0315295_1096570823300032156SedimentLFFHRHPRWTTWIIGAIPFALALFVFYSFLERVLPANY
Ga0307470_1186482513300032174Hardwood Forest SoilWWFLFHRYKKWYVWFAGAIPFIVVLFVFYTYLERLLPSNY
Ga0315276_1030697113300032177SedimentLPTLLSALIVLLIGALWWLFFHRHPRWTTWIIGAIPFALALFVFYSFLERVLPANY
Ga0315287_1018532513300032397SedimentTLLSGLVLLLVGLLWWLFFHRHPRWTTWIVGAIPFAIALFIFFSYLERVLPANY
Ga0247829_1074126313300033550SoilGERQSRTPTVLWGLITLAVGLLWWLWFHRHPRWTTWFSGLIPFAVALTVFYFFLERVLPNNY
Ga0314866_100718_398_5203300033807PeatlandWWLLFHRHARWTTWLIGAIPFAVVLFVFFTHLGHALPSNY
Ga0334977_0349215_559_6993300033978FreshwaterALVGGLWWLLFHRHPRWTTWVLGGVPFALALGYFFVLLERALPANY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.