Basic Information | |
---|---|
Family ID | F084322 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 43 residues |
Representative Sequence | MFSIDDRAGNVVTTVAIFLVAAAILYLARGAFFILLLSLLFAYLLEP |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.32 % |
% of genes near scaffold ends (potentially truncated) | 98.21 % |
% of genes from short scaffolds (< 2000 bps) | 90.18 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.321 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.67% β-sheet: 0.00% Coil/Unstructured: 41.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF03729 | DUF308 | 47.32 |
PF01435 | Peptidase_M48 | 10.71 |
PF00300 | His_Phos_1 | 5.36 |
PF01434 | Peptidase_M41 | 3.57 |
PF00210 | Ferritin | 2.68 |
PF06897 | DUF1269 | 1.79 |
PF00662 | Proton_antipo_N | 0.89 |
PF01081 | Aldolase | 0.89 |
PF03705 | CheR_N | 0.89 |
PF12704 | MacB_PCD | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 47.32 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 3.57 |
COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 1.79 |
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.79 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 1.79 |
COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.32 % |
Unclassified | root | N/A | 27.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS401AJWI1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 537 | Open in IMG/M |
3300003219|JGI26341J46601_10181263 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300003351|JGI26346J50198_1025795 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300003368|JGI26340J50214_10015064 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
3300004152|Ga0062386_100528778 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300005332|Ga0066388_100619481 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300005332|Ga0066388_104739786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
3300005764|Ga0066903_100136378 | All Organisms → cellular organisms → Bacteria | 3472 | Open in IMG/M |
3300006050|Ga0075028_100571933 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300006086|Ga0075019_10755510 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300006354|Ga0075021_10277728 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300009038|Ga0099829_11234723 | Not Available | 619 | Open in IMG/M |
3300009698|Ga0116216_10379130 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300009762|Ga0116130_1146451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 744 | Open in IMG/M |
3300009792|Ga0126374_11137146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 621 | Open in IMG/M |
3300009824|Ga0116219_10277223 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300010048|Ga0126373_10512658 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300010048|Ga0126373_11936366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 652 | Open in IMG/M |
3300010048|Ga0126373_12783396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 546 | Open in IMG/M |
3300010341|Ga0074045_10082564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 2247 | Open in IMG/M |
3300010343|Ga0074044_10018287 | All Organisms → cellular organisms → Bacteria | 5118 | Open in IMG/M |
3300010343|Ga0074044_10277235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1105 | Open in IMG/M |
3300010376|Ga0126381_102338506 | Not Available | 767 | Open in IMG/M |
3300010376|Ga0126381_103700272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 598 | Open in IMG/M |
3300010379|Ga0136449_101368068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1096 | Open in IMG/M |
3300014151|Ga0181539_1056978 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300015372|Ga0132256_101044875 | Not Available | 932 | Open in IMG/M |
3300016270|Ga0182036_10009193 | All Organisms → cellular organisms → Bacteria | 5176 | Open in IMG/M |
3300016319|Ga0182033_10094262 | Not Available | 2185 | Open in IMG/M |
3300016341|Ga0182035_10308451 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300016341|Ga0182035_10911378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 776 | Open in IMG/M |
3300016357|Ga0182032_10742700 | Not Available | 826 | Open in IMG/M |
3300016371|Ga0182034_10253042 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300016404|Ga0182037_10830353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 798 | Open in IMG/M |
3300016422|Ga0182039_10703299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 891 | Open in IMG/M |
3300017924|Ga0187820_1200153 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300017933|Ga0187801_10292202 | Not Available | 662 | Open in IMG/M |
3300017943|Ga0187819_10332748 | Not Available | 879 | Open in IMG/M |
3300017943|Ga0187819_10862288 | Not Available | 507 | Open in IMG/M |
3300017946|Ga0187879_10876784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 502 | Open in IMG/M |
3300017955|Ga0187817_10440333 | Not Available | 831 | Open in IMG/M |
3300017974|Ga0187777_10920119 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 629 | Open in IMG/M |
3300018006|Ga0187804_10170213 | Not Available | 923 | Open in IMG/M |
3300018006|Ga0187804_10337192 | Not Available | 661 | Open in IMG/M |
3300018007|Ga0187805_10032989 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300018009|Ga0187884_10085490 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300018012|Ga0187810_10295285 | Not Available | 670 | Open in IMG/M |
3300018016|Ga0187880_1361722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 613 | Open in IMG/M |
3300018019|Ga0187874_10237577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 750 | Open in IMG/M |
3300018022|Ga0187864_10254063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 804 | Open in IMG/M |
3300018024|Ga0187881_10051528 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300018046|Ga0187851_10103740 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
3300018086|Ga0187769_10609501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 825 | Open in IMG/M |
3300018090|Ga0187770_11560054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 538 | Open in IMG/M |
3300019082|Ga0187852_1230874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 754 | Open in IMG/M |
3300020579|Ga0210407_11241890 | Not Available | 559 | Open in IMG/M |
3300021046|Ga0215015_10704801 | Not Available | 658 | Open in IMG/M |
3300021171|Ga0210405_11307156 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021401|Ga0210393_10004491 | All Organisms → cellular organisms → Bacteria | 11026 | Open in IMG/M |
3300021432|Ga0210384_11900825 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300021478|Ga0210402_10895499 | Not Available | 814 | Open in IMG/M |
3300021559|Ga0210409_11048331 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300025439|Ga0208323_1031112 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300025480|Ga0208688_1044398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 987 | Open in IMG/M |
3300025507|Ga0208188_1145473 | Not Available | 506 | Open in IMG/M |
3300026862|Ga0207724_1023708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 524 | Open in IMG/M |
3300026872|Ga0207785_1023934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 534 | Open in IMG/M |
3300027173|Ga0208097_1016350 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300027645|Ga0209117_1031581 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300027680|Ga0207826_1157866 | Not Available | 618 | Open in IMG/M |
3300027898|Ga0209067_10813067 | Not Available | 546 | Open in IMG/M |
3300027903|Ga0209488_10448283 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300027911|Ga0209698_11386388 | Not Available | 512 | Open in IMG/M |
3300030659|Ga0316363_10092189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1357 | Open in IMG/M |
3300030855|Ga0075374_10929120 | Not Available | 519 | Open in IMG/M |
3300031231|Ga0170824_116340354 | Not Available | 888 | Open in IMG/M |
3300031231|Ga0170824_122488054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1490 | Open in IMG/M |
3300031668|Ga0318542_10671841 | Not Available | 541 | Open in IMG/M |
3300031720|Ga0307469_11158535 | Not Available | 729 | Open in IMG/M |
3300031724|Ga0318500_10506431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 607 | Open in IMG/M |
3300031753|Ga0307477_10821127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 617 | Open in IMG/M |
3300031754|Ga0307475_10244800 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300031768|Ga0318509_10556248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 640 | Open in IMG/M |
3300031823|Ga0307478_11792835 | Not Available | 505 | Open in IMG/M |
3300031879|Ga0306919_11305961 | Not Available | 549 | Open in IMG/M |
3300031890|Ga0306925_10347212 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300031897|Ga0318520_10464659 | Not Available | 779 | Open in IMG/M |
3300031945|Ga0310913_10975277 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031947|Ga0310909_11159968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 626 | Open in IMG/M |
3300031947|Ga0310909_11477499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 542 | Open in IMG/M |
3300031954|Ga0306926_10746917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1183 | Open in IMG/M |
3300031962|Ga0307479_10948225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 831 | Open in IMG/M |
3300031962|Ga0307479_11736191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 577 | Open in IMG/M |
3300031962|Ga0307479_11869750 | Not Available | 551 | Open in IMG/M |
3300032001|Ga0306922_11815357 | Not Available | 600 | Open in IMG/M |
3300032160|Ga0311301_10058461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 8517 | Open in IMG/M |
3300032174|Ga0307470_10604746 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300032174|Ga0307470_11322458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 591 | Open in IMG/M |
3300032770|Ga0335085_11003909 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300032782|Ga0335082_11710017 | Not Available | 503 | Open in IMG/M |
3300032783|Ga0335079_11352622 | Not Available | 709 | Open in IMG/M |
3300032783|Ga0335079_11805850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 595 | Open in IMG/M |
3300032783|Ga0335079_11827339 | Not Available | 590 | Open in IMG/M |
3300032805|Ga0335078_11555926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 735 | Open in IMG/M |
3300032892|Ga0335081_11542861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 733 | Open in IMG/M |
3300032892|Ga0335081_12647392 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032897|Ga0335071_11517954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
3300033158|Ga0335077_10932137 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300033402|Ga0326728_10098420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 3556 | Open in IMG/M |
3300033983|Ga0371488_0337106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 712 | Open in IMG/M |
3300034091|Ga0326724_0079251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2225 | Open in IMG/M |
3300034091|Ga0326724_0421007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 703 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.04% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.04% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.36% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.46% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.46% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.57% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.57% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.68% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_09029980 | 2189573004 | Grass Soil | MFSLDDHAGNVVTTVALFAIVGVILYVARAAVLVFLLSLLFGYLLEPAVKFVEKRS |
JGI26341J46601_101812631 | 3300003219 | Bog Forest Soil | MFSLDDRAGNVVTTVTLFMVAATILYVARGAFLVLFLSLLFAYLLQPAVTW |
JGI26346J50198_10257951 | 3300003351 | Bog Forest Soil | MFAIDDRTGNAVTTVALFLIAAGVLYQARGAFFVMLLSLLIAYLLEPAVMFV |
JGI26340J50214_100150641 | 3300003368 | Bog Forest Soil | MFSLDDRAGNVVTTVTLFMVAATILYVARGAFLVLFLSLLF |
Ga0062386_1005287783 | 3300004152 | Bog Forest Soil | MFSIDDRTGNVVTTVALFLVAMTILYLARGAFFILLLSLLFAY |
Ga0066388_1006194811 | 3300005332 | Tropical Forest Soil | MFEIDDRTGNVITTVALFAIAAVVLYVARGAFFLLVLSVLFAYLLEPAVNLVHRRSG |
Ga0066388_1047397861 | 3300005332 | Tropical Forest Soil | MFLLDDRAGNVITTVALFLVAATILYVARGAFFILLLSLLFAYLL |
Ga0066903_1001363786 | 3300005764 | Tropical Forest Soil | MFSIDDRAGNVMTTVVVFLIAAAIVYLARGAFFILLLSLLF |
Ga0075028_1005719331 | 3300006050 | Watersheds | MFSLRDRAGNVVTTVALFMAAAAIIYLARRVFLILMLSLLFAYLLEPAVTW |
Ga0075019_107555102 | 3300006086 | Watersheds | MLSIDDRAGNVVTTVALFLISAAVLYLARSAFFVLLLSLLFAYLLEPLVSFA |
Ga0075021_102777283 | 3300006354 | Watersheds | MLSIDDRAGNVMTTVAVFVIAASILYLARGAFFILLLSLLFAY |
Ga0099829_112347231 | 3300009038 | Vadose Zone Soil | MFSIDDRAGNVVTTVALFLVAAAILYLARGAFFILLL |
Ga0116216_103791302 | 3300009698 | Peatlands Soil | MFSIDDRTGNVLTTVALFLTAAAILYLARVAFLVVLGSILFAHLLEPAVTA |
Ga0116130_11464512 | 3300009762 | Peatland | MFSLDNRAGNVVTTVAVFVIGATILYLARGAFLILLLSILFA |
Ga0126374_111371461 | 3300009792 | Tropical Forest Soil | MFAIDDRTGNVITTVALFAIAAVVLYVARGAFFILLLSV |
Ga0116219_102772232 | 3300009824 | Peatlands Soil | MFSIDDRTGNVLTTVALFLTAAAILYLARVAFLVVLGSILFAHLLEPAVTAVQVH |
Ga0126373_105126581 | 3300010048 | Tropical Forest Soil | MFSLDDRTGNVISTIALFLIGFAVLYLARRAFLILVISLLFADLLEPM |
Ga0126373_119363661 | 3300010048 | Tropical Forest Soil | MFSIDDRTGNIVTTVALFLLGAAVIYLARRAFLILVISLLFADLLEP |
Ga0126373_127833962 | 3300010048 | Tropical Forest Soil | MFAIDDRTGNVITTVALFAIAAVVLYVARGAFFILVLSVLFAYLL |
Ga0074045_100825641 | 3300010341 | Bog Forest Soil | MFSIDDRAGNVITTVALFLAAAAILYLARGAFFILLLSL |
Ga0074044_100182878 | 3300010343 | Bog Forest Soil | MFSFDDRAGNVVTTVALFMAAATILYLARGAFLILLLSLLFAYLLEP |
Ga0074044_102772353 | 3300010343 | Bog Forest Soil | MFSVDDRTGNVVTTVALFVIAATIVYIARGVFLVLVLSVL |
Ga0126381_1023385063 | 3300010376 | Tropical Forest Soil | MFSIDDRTGNVVTTVALFLIAATVLYVARGAFFVLLLSLLFAY |
Ga0126381_1037002721 | 3300010376 | Tropical Forest Soil | MFSIDDRTGNIVTTVALFLLGAAVLYLARRAFLILVISLLFADLLEP |
Ga0136449_1013680681 | 3300010379 | Peatlands Soil | MFRVDDRTGNVVTTLAIFVTVATILYITRGAFLILLLSLLFAYLLEP |
Ga0181539_10569783 | 3300014151 | Bog | MLSLDNRAGNVVTTVAVFAIVGTILYLARGAFFILLLSILFAYLLE |
Ga0132256_1010448752 | 3300015372 | Arabidopsis Rhizosphere | MLSIDDRAGNVMTTVAIFVIAASILYVARGALFILLLSLLFAYLLEPP |
Ga0182036_100091937 | 3300016270 | Soil | MFSIDDHAGNTVFMVAATIFYVARGAFLVLFLSLLFAYLLEPAV |
Ga0182033_100942624 | 3300016319 | Soil | MFSIDDRTGNIVTTVALFLIGAAVLYLARRAFLIL |
Ga0182035_103084513 | 3300016341 | Soil | MFSIDDRVGNVMTTVAVFLMAATILYLARGAFFILLLS |
Ga0182035_109113781 | 3300016341 | Soil | MLSIDDRAGNVITTLALFIIAAAVLYLARGAFFILLLSLLFAYLLEP |
Ga0182032_107427001 | 3300016357 | Soil | MFSLDNRTGNVVTTVALFLIGAAVLYLARRTFLILIISLLFADLLEPLVAVVQRR |
Ga0182034_102530423 | 3300016371 | Soil | MFSLDDHAGNVVTTVALFMVAASILYLARVAFIILLLSLLF |
Ga0182037_108303531 | 3300016404 | Soil | MFSIDDRAGNVVTTVALFLIAASILYLARGAFFILLLSVLFAYLLEPA |
Ga0182039_107032991 | 3300016422 | Soil | MFSIDDRTGNIVTTVAFFLIGAAVVYLARRAFLILVVSLLFADLLEPAVAFFQKNLR |
Ga0187820_12001531 | 3300017924 | Freshwater Sediment | MFSIDDRTGNVITTGALFLAAAAILYLARGAFFILLLSLLFAYL |
Ga0187801_102922021 | 3300017933 | Freshwater Sediment | MFSIDDRTGNVVTTVILFLIAAAILYLARVTFFILLASILFAHLLEPA |
Ga0187819_103327482 | 3300017943 | Freshwater Sediment | MFSIDDRTGNVVTTVILFLIAAAILYLARVTFLILLASILFAHLLEPAV |
Ga0187819_108622882 | 3300017943 | Freshwater Sediment | MFSIDDRAGNVVTTVAIFLVAAAILYLARGAFFILLLSLLFAYLLEP |
Ga0187879_108767842 | 3300017946 | Peatland | MFRIDDRAGNVVTTVAIFVIAAAILYIARGAFLIL |
Ga0187817_104403331 | 3300017955 | Freshwater Sediment | MFSLDDRAGNVVTTVALFTVAAAVLYLARGAFLILLLSALFAYLIEPP |
Ga0187777_109201191 | 3300017974 | Tropical Peatland | MFSIDDRTGNVLTTITIFSLAAAILYSARGSLFILLLSLFFAYLLEP |
Ga0187804_101702132 | 3300018006 | Freshwater Sediment | MFSIDDRTGNVVTTVILFLIAAAILYLARVAFLVVLGSILFAHLLEPAVTA |
Ga0187804_103371921 | 3300018006 | Freshwater Sediment | MFSLDNRAGNVLTTVAVFVLAATILYIARGAFLILLLSLLFAYL |
Ga0187805_100329894 | 3300018007 | Freshwater Sediment | MFSVDDRTGNVVTTVALFLIAAAILYLARDAFLIVL |
Ga0187884_100854903 | 3300018009 | Peatland | MFSLDNRAGNVVTTVAVFVIGATILYLARGAFFILLLSIFFAYLL |
Ga0187810_102952852 | 3300018012 | Freshwater Sediment | MFSIDDRAGNVVTTVILFLIAAAILYLARVAFLIL |
Ga0187880_13617221 | 3300018016 | Peatland | MFSLDDRAGNVVTTVALFVGAAAVLYLARGAFLILVL |
Ga0187874_102375772 | 3300018019 | Peatland | MFSLDNRAGNVVTTVAVFVIGATILYLARGAFLILLLSILF |
Ga0187864_102540631 | 3300018022 | Peatland | MFSFDDHTGNVVTTVALFAGVAAIVYLARGALLILLLSI |
Ga0187881_100515281 | 3300018024 | Peatland | MLSIDDRTGNVVTTVALFLAAASILYLARGAFFILLLSLLFAYL |
Ga0187851_101037401 | 3300018046 | Peatland | MFSLDDRAGNVVTTVALFVGAGAVLYLARGALLILPLSVLFAYLLEPAVA |
Ga0187769_106095011 | 3300018086 | Tropical Peatland | MFSVDNRAGNVLTTAALFVIAATVLYLARGAFLILLLSILFALLLEPAVTFVQEHSP |
Ga0187770_115600541 | 3300018090 | Tropical Peatland | MFSLDNRTGNVVTTVGLFAIAAAILYIARGAFLILVLSVLFAYLLEPA |
Ga0187852_12308741 | 3300019082 | Peatland | MFSLDDRAGNVVTTVALFVGAATVLYLARGAFLILLLSV |
Ga0210407_112418902 | 3300020579 | Soil | MFSIDDRAGNVVTTVALFLLGATILYIARGAFLIRVL |
Ga0215015_107048012 | 3300021046 | Soil | MMSLDDRTGNVITTVALFMIAAAILYLARGAFFILLLSL |
Ga0210405_113071562 | 3300021171 | Soil | MFSLDDRAGNVATTVAAFMVAAAILYLARVAFLVLLL |
Ga0210393_1000449113 | 3300021401 | Soil | MFRIDDRTSDVVSTVALFLAVVAILYLARSAFFILLLSLLFAYLLEPV |
Ga0210384_119008251 | 3300021432 | Soil | MFSLDDRAGNVVTTVTFFMVAVTILYMARVAFLIL |
Ga0210402_108954992 | 3300021478 | Soil | VFSLDDRAGNVVTTVALFLLAAAVLYIARGAFLILLLSLSLPT |
Ga0210409_110483311 | 3300021559 | Soil | MFSLDDRAGNVVTTAAVFVAVVAMLYLARVAFLVLLLALLFAYLI |
Ga0208323_10311121 | 3300025439 | Peatland | MFSLDDRAGNVVTTVALFVGAGAVLYLARGALLILPLSVLFAYL |
Ga0208688_10443981 | 3300025480 | Peatland | MFSLDNRAGNVVTTVAVFAIGATILYLARGAFLILLLSILFAYLLE |
Ga0208188_11454732 | 3300025507 | Peatland | MFSLDNRTGNVVTTVAVFAIGATILYLARGAFLIFLLSILFA |
Ga0207724_10237082 | 3300026862 | Tropical Forest Soil | MFSIDDHAGNVVTTVTVFMVAATILYVARGAFLVLF |
Ga0207785_10239341 | 3300026872 | Tropical Forest Soil | MFSIDDHAGNVVTTVTVFMVAATILYVARGAFLILFLSLLFAYLLEPAVAWIQHHS |
Ga0208097_10163502 | 3300027173 | Forest Soil | MFSLDDRAGNVVTTVAVFAAAAAVLYLARVAFLVLLLALLFAYL |
Ga0209117_10315811 | 3300027645 | Forest Soil | MLSIDDRAGNVITTVALFVIAAAILYLARGAFFILLLSLLFAYLLEPA |
Ga0207826_11578661 | 3300027680 | Tropical Forest Soil | MFSIDDRTGNVVTTVILFLIAAAILYLARGAFLILLGSILFAHLLE |
Ga0209067_108130672 | 3300027898 | Watersheds | MLSIDDRAGNVVTTVALFLISAAVLYLARSAFFIL |
Ga0209488_104482831 | 3300027903 | Vadose Zone Soil | MFSLDDRTGNAVTTVAVFMLAATILYLARGALLILF |
Ga0209698_113863881 | 3300027911 | Watersheds | LFSLDDRAGNVVTTVALFLAASAILYLARGAFLILLLSLLFA |
Ga0316363_100921893 | 3300030659 | Peatlands Soil | MFSIDDRTGNVVTTVALFLVAVAILYLARGAFFILLLSLLFAYLLEPAV |
Ga0075374_109291201 | 3300030855 | Soil | MLSIDDRAGNVMTTVAIFVIAGSILYLARGAFFILLLSLL |
Ga0170824_1163403541 | 3300031231 | Forest Soil | MLSIDDRAGNVVTTVALFLIAAAVLYLARSAFFILLLSLLF |
Ga0170824_1224880541 | 3300031231 | Forest Soil | MFSIDDRTGNVVTTVALFLIAATVLYVARGAFFVLLLSLLFAYLLEP |
Ga0318542_106718411 | 3300031668 | Soil | MFSIDDRAGNVVTTVALFLTAASILYLARGAFFIL |
Ga0307469_111585352 | 3300031720 | Hardwood Forest Soil | MFSIDDRAGNVATTLALFLIGVAILYLGRGAFLILLLSI |
Ga0318500_105064311 | 3300031724 | Soil | MFSIDDHAGNTVFMVAATIFYVARGAFLVLFLSLLFAYLLEPAVTCIEH |
Ga0307477_108211271 | 3300031753 | Hardwood Forest Soil | MFSLDDRAGNVITTVALFMVAAAILYLARASFLVLLLSLLFA |
Ga0307475_102448001 | 3300031754 | Hardwood Forest Soil | MLSIDDRAGNVMTTVALFVIAASILYLARGAFFILLLSLLFAYLL |
Ga0318509_105562481 | 3300031768 | Soil | MFAIDDRTGNIVTTVAVFLIAGLVLYLARGAFFILLLSLLFAYLLEP |
Ga0307478_117928351 | 3300031823 | Hardwood Forest Soil | MFSLDDRAGNVVTTVTFFVVAMTILYMARVAFLILLLSLLFAYLLE |
Ga0306919_113059611 | 3300031879 | Soil | MFSIDDRTGNIVTTVALFLIGAAVLYLARRAFLILVIA |
Ga0306925_103472124 | 3300031890 | Soil | MFSIDDRVGNVMTTVAVFLMAATILYLARGAFFMLLLSLLFAYLLEP |
Ga0318520_104646591 | 3300031897 | Soil | MFSLDDHAGNVVTTVALFMVGASILYLARVAFIILLLSLLFAYLLE |
Ga0310913_109752772 | 3300031945 | Soil | MFSLDDRTGNVVTTVVLFAIAATILYLARGAFFILLLSLLFAYLLEPAVTLVQRH |
Ga0310909_111599682 | 3300031947 | Soil | MFSIDDHAGNTVFMVAATIFYVARGAFLVLFLSLLFAYLLEPAVTCIE |
Ga0310909_114774991 | 3300031947 | Soil | MFSLDNRAGNIITTVALFVVAGTILYVARGAFFVLLL |
Ga0306926_107469173 | 3300031954 | Soil | MFSIDDRTGNIVTTVAFFLIGAAVVYLARRAFLILVVSLLFAD |
Ga0307479_109482251 | 3300031962 | Hardwood Forest Soil | MFSLDDRAGNVVTTVVLFLLAAIIVYLARGAFLVLLLSLFFAYLLE |
Ga0307479_117361911 | 3300031962 | Hardwood Forest Soil | MFSLDDRTGNVVTTVALFIAAAAILYMARGAFLVLLLSLLFAYLLEPA |
Ga0307479_118697501 | 3300031962 | Hardwood Forest Soil | MLSIDDRTGNVVTTVALFMLAAAVLYLARSAFFILLLS |
Ga0306922_118153572 | 3300032001 | Soil | MFSIDDRTGNIVTTVALFLIGAAVLYLARRAFLILVIALL |
Ga0311301_100584619 | 3300032160 | Peatlands Soil | MFSLDNRAGNVMTTVAIFVIAAAILYVARGAFLILLLS |
Ga0307470_106047461 | 3300032174 | Hardwood Forest Soil | MLSPDDRIGNAVTTVAVFMLVATILSLARGGLLILFLS |
Ga0307470_113224581 | 3300032174 | Hardwood Forest Soil | MFSLDDRTGNVVTTVALFMAAAAILYMARGAFLVLL |
Ga0335085_110039091 | 3300032770 | Soil | MFSIDDRTGNVITTGALFLAAAAILYLARGAFFILLLSLLF |
Ga0335082_117100172 | 3300032782 | Soil | MFSFDDRTGNVITTAAIFIIAATVLYIARGAFLIMLLSLLFAYLL |
Ga0335079_113526222 | 3300032783 | Soil | MFSIDDRTGNVVTTVALFLIAAAILYLAHLTFLILVASILFAHM |
Ga0335079_118058502 | 3300032783 | Soil | MFSLDDRAGNVVTTVALFVGAGAVLYLARGAVLILLLSVLFAY |
Ga0335079_118273391 | 3300032783 | Soil | MFSLDNRTGNVVTTVALFIVAAAILYLARGAFLTL |
Ga0335078_115559261 | 3300032805 | Soil | MFRIDDRAGNVVTTVALFVIAATILYIARGAFLVLLLSLFF |
Ga0335081_115428611 | 3300032892 | Soil | MFSIDDHAGNVVTTVTVFTVAATILYVARGAFLVLFLS |
Ga0335081_126473921 | 3300032892 | Soil | MFSIDDRTGNVITTGALFLAAAAILYLARGAFFIL |
Ga0335071_115179541 | 3300032897 | Soil | MFSVDDRTGNVVTTVVLFLIAAAILYLARGAFLIVLGSILFA |
Ga0335077_109321372 | 3300033158 | Soil | MFSLDDRTGNVITTVAIFMIAATILYIVRGALLLL |
Ga0326728_100984206 | 3300033402 | Peat Soil | MFRIDDRAGNVVTTVALFVIAVSILYIARGAFLIMLLSLLFAYLLEPA |
Ga0371488_0337106_2_133 | 3300033983 | Peat Soil | MFSIDDRTGNAVTTVALFVIAAAILYVARGAFLILVLAVLFAYL |
Ga0326724_0079251_3_155 | 3300034091 | Peat Soil | MFRIDDRAGNVVTTVALFVIAATILYIARGAFLVLLLSLLFSYLLEPAVTW |
Ga0326724_0421007_571_702 | 3300034091 | Peat Soil | MFRIDDHAGNVVTTVALFVIAATILYIARGAFLILLLSLLFAYL |
⦗Top⦘ |