Basic Information | |
---|---|
Family ID | F084227 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 47 residues |
Representative Sequence | MINSIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 65.18 % |
% of genes near scaffold ends (potentially truncated) | 31.25 % |
% of genes from short scaffolds (< 2000 bps) | 68.75 % |
Associated GOLD sequencing projects | 67 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (72.321 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (37.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (82.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.036 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01844 | HNH | 3.57 |
PF03354 | TerL_ATPase | 1.79 |
PF00145 | DNA_methylase | 1.79 |
PF05869 | Dam | 1.79 |
PF12850 | Metallophos_2 | 0.89 |
PF16778 | Phage_tail_APC | 0.89 |
PF02018 | CBM_4_9 | 0.89 |
PF01527 | HTH_Tnp_1 | 0.89 |
PF04586 | Peptidase_S78 | 0.89 |
PF05065 | Phage_capsid | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.79 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.79 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.89 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10004105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5819 | Open in IMG/M |
3300000756|JGI12421J11937_10017577 | All Organisms → Viruses → Predicted Viral | 2669 | Open in IMG/M |
3300002408|B570J29032_108772483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300002835|B570J40625_100322357 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
3300003277|JGI25908J49247_10027734 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
3300003277|JGI25908J49247_10087577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300003393|JGI25909J50240_1046352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300003394|JGI25907J50239_1001860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5119 | Open in IMG/M |
3300003394|JGI25907J50239_1114933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300003431|JGI25913J50563_1024864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300003431|JGI25913J50563_1041115 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300003490|JGI25926J51410_1007793 | All Organisms → Viruses → Predicted Viral | 2230 | Open in IMG/M |
3300003493|JGI25923J51411_1044815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300003497|JGI25925J51416_10080012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300005517|Ga0070374_10033417 | All Organisms → Viruses → Predicted Viral | 2659 | Open in IMG/M |
3300005527|Ga0068876_10063606 | All Organisms → Viruses → Predicted Viral | 2233 | Open in IMG/M |
3300005527|Ga0068876_10151006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
3300005527|Ga0068876_10208171 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
3300005662|Ga0078894_10742290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300006037|Ga0075465_10060022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300006484|Ga0070744_10057693 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300006484|Ga0070744_10063471 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
3300007622|Ga0102863_1133903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300007972|Ga0105745_1012299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2031 | Open in IMG/M |
3300008119|Ga0114354_1000689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15720 | Open in IMG/M |
3300008261|Ga0114336_1371807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300008450|Ga0114880_1078900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300009026|Ga0102829_1255421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300009068|Ga0114973_10038119 | All Organisms → cellular organisms → Bacteria | 2877 | Open in IMG/M |
3300009068|Ga0114973_10366293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 759 | Open in IMG/M |
3300009152|Ga0114980_10007450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7163 | Open in IMG/M |
3300009155|Ga0114968_10283576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 931 | Open in IMG/M |
3300009158|Ga0114977_10021534 | All Organisms → Viruses → Predicted Viral | 4050 | Open in IMG/M |
3300009158|Ga0114977_10180165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1247 | Open in IMG/M |
3300009159|Ga0114978_10038151 | All Organisms → Viruses → Predicted Viral | 3390 | Open in IMG/M |
3300009159|Ga0114978_10141596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1556 | Open in IMG/M |
3300009164|Ga0114975_10059886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2232 | Open in IMG/M |
3300009164|Ga0114975_10673831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300009168|Ga0105104_10530582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300009181|Ga0114969_10114124 | All Organisms → Viruses → Predicted Viral | 1727 | Open in IMG/M |
3300009183|Ga0114974_10015567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5438 | Open in IMG/M |
3300009183|Ga0114974_10068050 | All Organisms → Viruses → Predicted Viral | 2341 | Open in IMG/M |
3300009183|Ga0114974_10643983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300009183|Ga0114974_10814200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300009185|Ga0114971_10157474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
3300009194|Ga0114983_1019769 | All Organisms → Viruses → Predicted Viral | 1795 | Open in IMG/M |
3300010160|Ga0114967_10021476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4509 | Open in IMG/M |
3300012702|Ga0157596_1026803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300013006|Ga0164294_10145417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
3300017701|Ga0181364_1077199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300017722|Ga0181347_1061575 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
3300017747|Ga0181352_1165445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300017761|Ga0181356_1176120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300017766|Ga0181343_1089623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300017774|Ga0181358_1269989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300017777|Ga0181357_1064270 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
3300017777|Ga0181357_1148910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300017777|Ga0181357_1196621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300017777|Ga0181357_1339506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300017778|Ga0181349_1024316 | All Organisms → Viruses → Predicted Viral | 2461 | Open in IMG/M |
3300017780|Ga0181346_1238420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300017785|Ga0181355_1360427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300018868|Ga0187844_10405684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300019784|Ga0181359_1002849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5147 | Open in IMG/M |
3300019784|Ga0181359_1052327 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
3300019784|Ga0181359_1083385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
3300019784|Ga0181359_1115945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300020161|Ga0211726_10181079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300020172|Ga0211729_10507347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
3300020172|Ga0211729_10597858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 644 | Open in IMG/M |
3300020540|Ga0208227_1055178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300022407|Ga0181351_1003752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5569 | Open in IMG/M |
3300024346|Ga0244775_10074696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2902 | Open in IMG/M |
3300025451|Ga0208426_1052368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300027365|Ga0209300_1015226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1877 | Open in IMG/M |
3300027563|Ga0209552_1013423 | All Organisms → Viruses → Predicted Viral | 2506 | Open in IMG/M |
3300027733|Ga0209297_1128655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300027734|Ga0209087_1002572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10166 | Open in IMG/M |
3300027734|Ga0209087_1009332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5085 | Open in IMG/M |
3300027734|Ga0209087_1062969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1656 | Open in IMG/M |
3300027734|Ga0209087_1332709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027754|Ga0209596_1040714 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
3300027754|Ga0209596_1078264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
3300027759|Ga0209296_1002586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12898 | Open in IMG/M |
3300027759|Ga0209296_1007851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6604 | Open in IMG/M |
3300027759|Ga0209296_1065413 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
3300027759|Ga0209296_1215125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300027760|Ga0209598_10003644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11580 | Open in IMG/M |
3300027763|Ga0209088_10005781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7043 | Open in IMG/M |
3300027763|Ga0209088_10077343 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
3300027764|Ga0209134_10011914 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300027764|Ga0209134_10329583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300027785|Ga0209246_10048643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
3300027797|Ga0209107_10000938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16542 | Open in IMG/M |
3300027798|Ga0209353_10007443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5434 | Open in IMG/M |
3300027798|Ga0209353_10058680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1763 | Open in IMG/M |
3300027798|Ga0209353_10092004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
3300027816|Ga0209990_10030902 | All Organisms → Viruses → Predicted Viral | 2877 | Open in IMG/M |
3300027892|Ga0209550_10443129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1146254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1259193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1112470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1242903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10071409 | All Organisms → Viruses → Predicted Viral | 2235 | Open in IMG/M |
3300031952|Ga0315294_10916831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300032092|Ga0315905_10003284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16732 | Open in IMG/M |
3300032092|Ga0315905_10003734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15664 | Open in IMG/M |
3300032516|Ga0315273_10895642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
3300033981|Ga0334982_0140196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
3300034104|Ga0335031_0107286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1964 | Open in IMG/M |
3300034167|Ga0335017_0380263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300034279|Ga0335052_0375578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 37.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 27.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.57% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.68% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.79% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.79% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.79% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.79% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.79% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100041053 | 3300000756 | Freshwater And Sediment | MINSITIIGMIGLLLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE* |
JGI12421J11937_100175775 | 3300000756 | Freshwater And Sediment | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
B570J29032_1087724831 | 3300002408 | Freshwater | MNSITIIGIIGLFLVSNFIWYWQGYKDGRREGWHKGRSLARSLADHAANEILLSA |
B570J40625_1003223574 | 3300002835 | Freshwater | MLGLLIASNFIWYWQGYKDGRREGYVRGRDLSRQGFWQE* |
JGI25908J49247_100277343 | 3300003277 | Freshwater Lake | MINSLTIIGMFGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE* |
JGI25908J49247_100875773 | 3300003277 | Freshwater Lake | MINSLTIIGMLGLAIASSFIWYWQGYKDGRREGYVRGRELNRQGFWQE* |
JGI25909J50240_10463522 | 3300003393 | Freshwater Lake | MINSLTIIGMLGLVIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE* |
JGI25907J50239_10018607 | 3300003394 | Freshwater Lake | MFGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE* |
JGI25907J50239_11149331 | 3300003394 | Freshwater Lake | MINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSL |
JGI25913J50563_10248642 | 3300003431 | Freshwater Lake | MINSITIVGMIGLLLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE* |
JGI25913J50563_10411153 | 3300003431 | Freshwater Lake | SITIVGMIGLLLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE* |
JGI25926J51410_10077933 | 3300003490 | Freshwater Lake | MINSLTIIGMLGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE* |
JGI25923J51411_10448152 | 3300003493 | Freshwater Lake | MINSLTIIGMFGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
JGI25925J51416_100800121 | 3300003497 | Freshwater Lake | MINSLTIIGMFGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQ |
Ga0070374_100334175 | 3300005517 | Freshwater Lake | MINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0068876_100636065 | 3300005527 | Freshwater Lake | MINSVVIIGMIGLLFISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0068876_101510063 | 3300005527 | Freshwater Lake | MNSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAS* |
Ga0068876_102081713 | 3300005527 | Freshwater Lake | MNSITIIGIIGLFLVTNFIWYWQGYKDGKREGWHKGRSLARSLADHAS* |
Ga0078894_107422903 | 3300005662 | Freshwater Lake | MIINSITIIGLIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0075465_100600222 | 3300006037 | Aqueous | MINSVTIIGIIGLFLATNFIWYWQGFRDGRREGYVRGRDLSRQGFWQE* |
Ga0070744_100576933 | 3300006484 | Estuarine | MINSIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0070744_100634713 | 3300006484 | Estuarine | MIVNSITIIGLIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0102863_11339031 | 3300007622 | Estuarine | AGGIMIINSITIIGLIGLFLATNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0105745_10122994 | 3300007972 | Estuary Water | MIINSITIIGLIGLFLATNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0114354_10006896 | 3300008119 | Freshwater, Plankton | MIINSLTIIGVLGIFFATNFVWYWQGFKDGRREGYARGRDLNRQGFWKE* |
Ga0114336_13718071 | 3300008261 | Freshwater, Plankton | LLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114880_10789003 | 3300008450 | Freshwater Lake | MINSVVIIGMIGLLLISNVFWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0102829_12554213 | 3300009026 | Estuarine | SIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0114973_100381193 | 3300009068 | Freshwater Lake | MINSVVIIGMMGLLLISNVIWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114973_103662933 | 3300009068 | Freshwater Lake | DRYTMINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114980_1000745010 | 3300009152 | Freshwater Lake | MMGLLFISNVIWYALGVKDGRREGYVRGRDLSRQGFWQE* |
Ga0114968_102835762 | 3300009155 | Freshwater Lake | MINSVVILGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114977_100215342 | 3300009158 | Freshwater Lake | MIINSITIIGLIGLFLATNFIWYWQGFKDGRREGYVRGRHLSRQGFWQE* |
Ga0114977_101801652 | 3300009158 | Freshwater Lake | MINSITIIGIIGLFLASNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0114978_100381518 | 3300009159 | Freshwater Lake | MNSITIIGIIGLFLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE* |
Ga0114978_101415963 | 3300009159 | Freshwater Lake | MIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0114975_100598866 | 3300009164 | Freshwater Lake | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYRRGRDLNRQGFWQE* |
Ga0114975_106738312 | 3300009164 | Freshwater Lake | MINSVTIIGIIGLFLATNFIWYWQGFRDGRREGYVRGRDLNRQGFFHE* |
Ga0105104_105305821 | 3300009168 | Freshwater Sediment | MNSITIIGIIGLFMATNFIWYWQGYKDGRRAGWHNGRNMARSLVDH |
Ga0114969_101141244 | 3300009181 | Freshwater Lake | AVKGTATDRYTMINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114974_100155671 | 3300009183 | Freshwater Lake | MINSITIIGLIGLFLASNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0114974_100680506 | 3300009183 | Freshwater Lake | MINSVVIIGMMGLLLISNVIWYAQGVKDGRREGYVRGRDLSRQGFWQE* |
Ga0114974_106439833 | 3300009183 | Freshwater Lake | MINSLVILGMMGLLFISNVIWYAQGVKDGRREGYVRGRDLSRQGFWQE* |
Ga0114974_108142002 | 3300009183 | Freshwater Lake | KGGKVMINSITIIGIIGLFLATNFIWYWQGFKDGRREGYRRGRDLNRQGFWQE* |
Ga0114971_101574744 | 3300009185 | Freshwater Lake | MINSVVIIGMIGFLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0114983_10197693 | 3300009194 | Deep Subsurface | MNSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAR* |
Ga0114967_100214768 | 3300010160 | Freshwater Lake | MINSVVIIGMMGLLFISNVIWYSQGFKDGRREGWHKARNLGRSLADK* |
Ga0157596_10268031 | 3300012702 | Freshwater | MNSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHASQ* |
Ga0164294_101454172 | 3300013006 | Freshwater | MIMNSITIIGLIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE* |
Ga0181364_10771992 | 3300017701 | Freshwater Lake | MINSITIIGMLGLAIASSFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
Ga0181347_10615753 | 3300017722 | Freshwater Lake | GMIGLLLISNVLWYSQGFKDGRREGWHRARNLGRSLADK |
Ga0181352_11654451 | 3300017747 | Freshwater Lake | NSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAS |
Ga0181356_11761201 | 3300017761 | Freshwater Lake | YTMINSITIIGMLGLAIASSFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
Ga0181343_10896232 | 3300017766 | Freshwater Lake | MRGDSMIINSITIIGLVGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0181358_12699893 | 3300017774 | Freshwater Lake | ADRDTMINSITIIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0181357_10642704 | 3300017777 | Freshwater Lake | GLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0181357_11489101 | 3300017777 | Freshwater Lake | RMNSITIIGIIGLFVVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAS |
Ga0181357_11966211 | 3300017777 | Freshwater Lake | MINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLA |
Ga0181357_13395061 | 3300017777 | Freshwater Lake | YTMINSITIIGMLGLLIASNFIWYWQGYKDGRREGYRRGRDLNRQGFWQE |
Ga0181349_10243167 | 3300017778 | Freshwater Lake | LLIASNFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
Ga0181346_12384201 | 3300017780 | Freshwater Lake | YTMINSITIIGMLGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0181355_13604271 | 3300017785 | Freshwater Lake | MMINSITIIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0187844_104056843 | 3300018868 | Freshwater | VTDRYTMINSLVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0181359_10028495 | 3300019784 | Freshwater Lake | MINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0181359_10523273 | 3300019784 | Freshwater Lake | MINSLTIIGMLGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0181359_10833852 | 3300019784 | Freshwater Lake | MLGLAIASSFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
Ga0181359_11159452 | 3300019784 | Freshwater Lake | MINSVVIIGMIGLLLISNVFWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0211726_101810791 | 3300020161 | Freshwater | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYARGRNLSRQGFWQE |
Ga0211729_105073474 | 3300020172 | Freshwater | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQRFWQE |
Ga0211729_105978581 | 3300020172 | Freshwater | IIGIIGLFLATNFIWYWQGFKDGRREGYARGRNLSRQGFWQE |
Ga0208227_10551781 | 3300020540 | Freshwater | MINSITIIGMLGLLIASNFIWYWQGYKDGRREGYVRGRDLSRQGFWQ |
Ga0181351_10037526 | 3300022407 | Freshwater Lake | MINSITIIGMLGLLIASNFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
Ga0244775_100746964 | 3300024346 | Estuarine | MINSIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0208426_10523682 | 3300025451 | Aqueous | MINSVTIIGIIGLFLATNFIWYWQGFRDGRREGYVRGRDLSRQGFWQE |
Ga0209300_10152262 | 3300027365 | Deep Subsurface | MNSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAR |
Ga0209552_10134234 | 3300027563 | Freshwater Lake | MFGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0209297_11286552 | 3300027733 | Freshwater Lake | MINSITIIGIIGLFLASNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0209087_10025727 | 3300027734 | Freshwater Lake | MIINSITIIGLIGLFLATNFIWYWQGFKDGRREGYVRGRHLSRQGFWQE |
Ga0209087_10093325 | 3300027734 | Freshwater Lake | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0209087_10629691 | 3300027734 | Freshwater Lake | MGLLLISNVIWYAQGVKDGRREGYVRGRDLSRQGFWQEXELMKSYLQ |
Ga0209087_13327093 | 3300027734 | Freshwater Lake | TIIGIIGLFLATNFIWYWQGFKDGRREGYRRGRDLNRQGFWQE |
Ga0209596_10407143 | 3300027754 | Freshwater Lake | MINSITIIGIIGLFLATNFIWYWQGFKDGRREGYRRGRDLNRQGFWQE |
Ga0209596_10782643 | 3300027754 | Freshwater Lake | MINSVVILGMIGLLLISNVLWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0209296_10025868 | 3300027759 | Freshwater Lake | MINSVTIIGIIGLFLATNFIWYWQGFRDGRREGYVRGRDLNRQGFFHE |
Ga0209296_10078517 | 3300027759 | Freshwater Lake | MIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0209296_10654134 | 3300027759 | Freshwater Lake | MINSVVIIGMMGLLLISNVIWYAQGVKDGRREGYVRGRDLSRQGFWQE |
Ga0209296_12151253 | 3300027759 | Freshwater Lake | IIGIIGLFLATNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0209598_1000364417 | 3300027760 | Freshwater Lake | MINSVVIIGMMGLLFISNVIWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0209088_100057818 | 3300027763 | Freshwater Lake | MMGLLFISNVIWYALGVKDGRREGYVRGRDLSRQGFWQE |
Ga0209088_100773433 | 3300027763 | Freshwater Lake | MNSITIIGIIGLFLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE |
Ga0209134_100119145 | 3300027764 | Freshwater Lake | MINSITIVGMIGLLLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE |
Ga0209134_103295832 | 3300027764 | Freshwater Lake | MNSITIIGIIGLFLATNFIWYWQGYKDGRREGWHKGRSLARSLADHAS |
Ga0209246_100486432 | 3300027785 | Freshwater Lake | MINSITIIGMLGLAIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0209107_1000093810 | 3300027797 | Freshwater And Sediment | MINSITIIGMIGLLLATNFIWYWQGVKDGKREGYVRGREISRQGFWQE |
Ga0209353_100074438 | 3300027798 | Freshwater Lake | MINSITIIGMLGLLIASNFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0209353_100586805 | 3300027798 | Freshwater Lake | MINSVVIIGMIGLLLISNVLWYSHGFKDGRREGWHKARNLGR |
Ga0209353_100920044 | 3300027798 | Freshwater Lake | TIIGMLGLVIASSFIWYWQGYKDGRREGYRRGRDLTRQGFWQE |
Ga0209990_100309025 | 3300027816 | Freshwater Lake | MINSVVIIGMIGLLFISNVLWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0209550_104431292 | 3300027892 | Freshwater Lake | MINSLTIIGMLGLAIASSFIWYWQGYKDGRREGYVRGRELNRQGFWQE |
(restricted) Ga0247834_11462543 | 3300027977 | Freshwater | MIGLLFISNVIWYSQGFKDGRREGWHKARNLGRSLADK |
(restricted) Ga0247834_12591931 | 3300027977 | Freshwater | MGLLLISNVIWYSQGFKDGRREGWHKARNLGRSLA |
(restricted) Ga0247838_11124703 | 3300028044 | Freshwater | MINSVVIIGMMGLLLISNVIWYSQGFKDGRREGWHKARNLGRSL |
(restricted) Ga0247844_12429032 | 3300028571 | Freshwater | MINSVVIIGMMGLLLISNVIWYSQGFKDGRREGWHKAR |
(restricted) Ga0247842_100714095 | 3300029268 | Freshwater | MINSVVIIGMMGLLLISNVIWYSQGFKDGRREGWHKARNLGRSLADK |
Ga0315294_109168313 | 3300031952 | Sediment | LFNQGRSCIIMINSIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0315905_1000328422 | 3300032092 | Freshwater | MINSVVIIGMIGLLLISNVLWYSQGFKDGRREGWHRARNLGRSLADK |
Ga0315905_100037346 | 3300032092 | Freshwater | MIINSLTIIGVLGIFFATNFVWYWQGFKDGRREGYARGRDLNRQGFWKE |
Ga0315273_108956424 | 3300032516 | Sediment | MINSIVIIGMIGLLLASNFIWYWQGFKDGRREGYVRGRDLSRHGFWQE |
Ga0334982_0140196_454_600 | 3300033981 | Freshwater | MNSITIIGIIGLFMATNFIWYWQGYKDGRREGWHKGRNMARSLVDHAS |
Ga0335031_0107286_1071_1217 | 3300034104 | Freshwater | MINSITIIGLIGLFLASNFVWYWQGFKDGRREGYVRGRDLSRQGFWQE |
Ga0335017_0380263_242_391 | 3300034167 | Freshwater | MINSITIIGLIGLFLASNFIWYWQGYKDGRREGWHKGRNMARSLVDHAS |
Ga0335052_0375578_200_367 | 3300034279 | Freshwater | MPMRGVSMNSITIIGIIGLFLVTNFIWYWQGYKDGRREGWHKGRSLARSLADHAS |
⦗Top⦘ |