Basic Information | |
---|---|
Family ID | F084193 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 37 residues |
Representative Sequence | ERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.21 % |
% of genes from short scaffolds (< 2000 bps) | 82.14 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.821 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.643 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.321 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.036 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 8.04 |
PF02371 | Transposase_20 | 2.68 |
PF07883 | Cupin_2 | 2.68 |
PF00583 | Acetyltransf_1 | 1.79 |
PF01828 | Peptidase_A4 | 1.79 |
PF13302 | Acetyltransf_3 | 1.79 |
PF12850 | Metallophos_2 | 1.79 |
PF08241 | Methyltransf_11 | 1.79 |
PF01230 | HIT | 1.79 |
PF01152 | Bac_globin | 0.89 |
PF06441 | EHN | 0.89 |
PF06224 | HTH_42 | 0.89 |
PF00096 | zf-C2H2 | 0.89 |
PF13474 | SnoaL_3 | 0.89 |
PF12680 | SnoaL_2 | 0.89 |
PF07228 | SpoIIE | 0.89 |
PF01019 | G_glu_transpept | 0.89 |
PF00155 | Aminotran_1_2 | 0.89 |
PF01741 | MscL | 0.89 |
PF05155 | Phage_X | 0.89 |
PF04542 | Sigma70_r2 | 0.89 |
PF01636 | APH | 0.89 |
PF01243 | Putative_PNPOx | 0.89 |
PF00561 | Abhydrolase_1 | 0.89 |
PF13749 | HATPase_c_4 | 0.89 |
PF00211 | Guanylate_cyc | 0.89 |
PF00005 | ABC_tran | 0.89 |
PF04794 | YdjC | 0.89 |
PF05974 | DUF892 | 0.89 |
PF06348 | DUF1059 | 0.89 |
PF01590 | GAF | 0.89 |
PF13460 | NAD_binding_10 | 0.89 |
PF07676 | PD40 | 0.89 |
PF03575 | Peptidase_S51 | 0.89 |
PF01022 | HTH_5 | 0.89 |
PF12681 | Glyoxalase_2 | 0.89 |
PF01872 | RibD_C | 0.89 |
PF01548 | DEDD_Tnp_IS110 | 0.89 |
PF08240 | ADH_N | 0.89 |
PF13669 | Glyoxalase_4 | 0.89 |
PF00884 | Sulfatase | 0.89 |
PF04545 | Sigma70_r4 | 0.89 |
PF02894 | GFO_IDH_MocA_C | 0.89 |
PF06803 | DUF1232 | 0.89 |
PF07366 | SnoaL | 0.89 |
PF01464 | SLT | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.57 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.89 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.89 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.89 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.89 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.89 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.89 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.89 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.89 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.89 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.89 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.89 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.89 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.89 |
COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.89 |
COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.82 % |
Unclassified | root | N/A | 15.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003994|Ga0055435_10003185 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
3300005529|Ga0070741_10003039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 42831 | Open in IMG/M |
3300005529|Ga0070741_10024859 | Not Available | 8919 | Open in IMG/M |
3300005529|Ga0070741_10070398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3948 | Open in IMG/M |
3300005529|Ga0070741_10153248 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300005764|Ga0066903_108284610 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006581|Ga0074048_10095357 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300006844|Ga0075428_101116493 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300009012|Ga0066710_102415011 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300009012|Ga0066710_102930248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300009789|Ga0126307_10275333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1353 | Open in IMG/M |
3300009840|Ga0126313_10074857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 2442 | Open in IMG/M |
3300009840|Ga0126313_10632339 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300009840|Ga0126313_11114720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300009840|Ga0126313_11195396 | Not Available | 626 | Open in IMG/M |
3300009840|Ga0126313_11424500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300010036|Ga0126305_10071187 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300010036|Ga0126305_10309651 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300010036|Ga0126305_10388832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300010037|Ga0126304_10186878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1352 | Open in IMG/M |
3300010037|Ga0126304_10782587 | Not Available | 647 | Open in IMG/M |
3300010038|Ga0126315_10355149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300010039|Ga0126309_11225460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-64-8 | 516 | Open in IMG/M |
3300010041|Ga0126312_10766199 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300010042|Ga0126314_10265481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1220 | Open in IMG/M |
3300010042|Ga0126314_11074569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300010044|Ga0126310_10025158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3047 | Open in IMG/M |
3300010166|Ga0126306_10143916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1765 | Open in IMG/M |
3300010166|Ga0126306_11116560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300010322|Ga0134084_10474910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300010323|Ga0134086_10195659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium | 753 | Open in IMG/M |
3300010366|Ga0126379_13566968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300011003|Ga0138514_100001609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2846 | Open in IMG/M |
3300012003|Ga0120163_1130212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300012014|Ga0120159_1046437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1395 | Open in IMG/M |
3300012043|Ga0136631_10021532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2328 | Open in IMG/M |
3300012094|Ga0136638_10040537 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300012186|Ga0136620_10104145 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300012186|Ga0136620_10272145 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012201|Ga0137365_10306947 | Not Available | 1175 | Open in IMG/M |
3300012204|Ga0137374_10499880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
3300012350|Ga0137372_10398936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
3300012350|Ga0137372_10779402 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012350|Ga0137372_11004785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300012360|Ga0137375_10267041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1569 | Open in IMG/M |
3300012679|Ga0136616_10186967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
3300012680|Ga0136612_10318471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 789 | Open in IMG/M |
3300012941|Ga0162652_100018817 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300013100|Ga0157373_11204465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300013100|Ga0157373_11235606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300013296|Ga0157374_12809704 | Not Available | 514 | Open in IMG/M |
3300013501|Ga0120154_1041490 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300013501|Ga0120154_1128572 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300014031|Ga0120173_1049929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
3300014325|Ga0163163_12012575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300015359|Ga0134085_10599074 | Not Available | 512 | Open in IMG/M |
3300015373|Ga0132257_102055158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
3300015374|Ga0132255_100304999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2293 | Open in IMG/M |
3300017695|Ga0180121_10400772 | Not Available | 533 | Open in IMG/M |
3300017966|Ga0187776_11565631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300018028|Ga0184608_10016272 | Not Available | 2628 | Open in IMG/M |
3300018052|Ga0184638_1009379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3279 | Open in IMG/M |
3300018052|Ga0184638_1327098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300018054|Ga0184621_10156894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
3300018075|Ga0184632_10033312 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300018078|Ga0184612_10200307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
3300018469|Ga0190270_11657307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
3300018476|Ga0190274_13069690 | Not Available | 561 | Open in IMG/M |
3300018482|Ga0066669_12385134 | Not Available | 507 | Open in IMG/M |
3300019869|Ga0193705_1083023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300019875|Ga0193701_1079341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
3300019888|Ga0193751_1071968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1409 | Open in IMG/M |
3300021445|Ga0182009_10400993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300022756|Ga0222622_10407532 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300025327|Ga0209751_10694232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300025552|Ga0210142_1004199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2644 | Open in IMG/M |
3300025854|Ga0209176_10158986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300025906|Ga0207699_11463551 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300025910|Ga0207684_11747204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300025921|Ga0207652_11624178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300025929|Ga0207664_11302067 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300025932|Ga0207690_11603215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300025981|Ga0207640_12077009 | Not Available | 515 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10095289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1015 | Open in IMG/M |
3300027857|Ga0209166_10491894 | Not Available | 631 | Open in IMG/M |
3300028573|Ga0265334_10101374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
3300028705|Ga0307276_10103119 | Not Available | 692 | Open in IMG/M |
3300028715|Ga0307313_10179262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300028720|Ga0307317_10013013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2491 | Open in IMG/M |
3300028744|Ga0307318_10272015 | Not Available | 592 | Open in IMG/M |
3300028778|Ga0307288_10135775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 918 | Open in IMG/M |
3300028787|Ga0307323_10223817 | Not Available | 679 | Open in IMG/M |
3300028791|Ga0307290_10220442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
3300028802|Ga0307503_10004632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3576 | Open in IMG/M |
3300028814|Ga0307302_10224166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
3300028819|Ga0307296_10173418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1168 | Open in IMG/M |
3300028819|Ga0307296_10626660 | Not Available | 589 | Open in IMG/M |
3300028824|Ga0307310_10456278 | Not Available | 640 | Open in IMG/M |
3300028872|Ga0307314_10203206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300028878|Ga0307278_10172842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 966 | Open in IMG/M |
3300028884|Ga0307308_10215071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
3300028885|Ga0307304_10103170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
3300028885|Ga0307304_10563666 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300029957|Ga0265324_10275010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300031450|Ga0272433_10000719 | All Organisms → cellular organisms → Bacteria | 66730 | Open in IMG/M |
3300031473|Ga0272434_1000264 | All Organisms → cellular organisms → Bacteria | 131616 | Open in IMG/M |
3300031473|Ga0272434_1088527 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
3300031781|Ga0318547_10492019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
3300031901|Ga0307406_10605968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
3300032089|Ga0318525_10058586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1922 | Open in IMG/M |
3300032261|Ga0306920_103282795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
3300032783|Ga0335079_11694466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.64% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 16.96% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 6.25% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.36% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.46% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 2.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.79% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0055435_100031851 | 3300003994 | Natural And Restored Wetlands | KQAEGKSRREAIRCLKRLLVRVVFNTLKSSPALTKEQHSRS* |
Ga0070741_100030391 | 3300005529 | Surface Soil | KQAEGKSRREALRCLKRQLARTIYTTLKNQPLLT* |
Ga0070741_100248591 | 3300005529 | Surface Soil | RKQAEGKSRREALRCLKRQLARTIYTTLKNQPLLT* |
Ga0070741_100703986 | 3300005529 | Surface Soil | ERKQSEGKSRREAIRCLKRQLARTVYTTHKSEPLLT* |
Ga0070741_101532484 | 3300005529 | Surface Soil | ERKRAEGKSRREALRCLKRLLIRVVFNTLKTSPALT* |
Ga0066903_1082846102 | 3300005764 | Tropical Forest Soil | YLERKRAEGKSWREAIRCLKRLLVRVVFQTLKTSPALT* |
Ga0074048_100953571 | 3300006581 | Soil | LERKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT* |
Ga0075428_1011164931 | 3300006844 | Populus Rhizosphere | ERKRGEGKSRREAIRCLKRQLARVVFNTLKAEPALT* |
Ga0066710_1024150113 | 3300009012 | Grasslands Soil | ERKQSEGKSRREALRCLKRQLVRTVYTTLKSESALT |
Ga0066710_1029302481 | 3300009012 | Grasslands Soil | RKQAEGKSRREAIRCVKRQLARVVFNTLKANPALT |
Ga0126307_102753331 | 3300009789 | Serpentine Soil | LERKQADGKSRREALRCLKRQLARTVYTTLKNEPALT* |
Ga0126313_100748571 | 3300009840 | Serpentine Soil | RKQSEGKSRREALRCLKRQLARTVFTTLKNESALT* |
Ga0126313_106323393 | 3300009840 | Serpentine Soil | RKQAEGKSRREAIRCLKRQLARVIFNTLKASPALT* |
Ga0126313_111147201 | 3300009840 | Serpentine Soil | LERKRNEGKSRREALRCLKRQLARTVYTTLKTESALT* |
Ga0126313_111953961 | 3300009840 | Serpentine Soil | KQSEGKSRREALRCLKRQLARTVFTTLKNESALT* |
Ga0126313_114245002 | 3300009840 | Serpentine Soil | ERKRNEGKSRREALRCLKRQLARTVYTTLKTESALT* |
Ga0126305_100711874 | 3300010036 | Serpentine Soil | KQADGKSRREALRCLKRQLARTVYTTLKNEPALT* |
Ga0126305_103096511 | 3300010036 | Serpentine Soil | KQGEGKSRREAIRCLKRLLVRVAFNTLKTSPALT* |
Ga0126305_103888323 | 3300010036 | Serpentine Soil | AYLERKQGEGKSRREAIRCLKRQLARTVYTTLKSEPSLT* |
Ga0126304_101868781 | 3300010037 | Serpentine Soil | KQAEGKSRREAIRCLKRQLARVVFNTLKASPTLT* |
Ga0126304_107825872 | 3300010037 | Serpentine Soil | YLERKQAEGKSRREAIRCLKRTLARVVFNTLKASPALT* |
Ga0126315_103551493 | 3300010038 | Serpentine Soil | KQGEGKSRREALRCLKRQLARTVYTTLKSEPSLT* |
Ga0126309_112254602 | 3300010039 | Serpentine Soil | RKRSEGKSRREALRCLKRLLVRVVFQTLKTSPALT* |
Ga0126312_107661991 | 3300010041 | Serpentine Soil | KQAEGKSRREALRCLKRQLARTVYTTLKTESALT* |
Ga0126314_102654811 | 3300010042 | Serpentine Soil | RKQAEGKSRREAIRCLKRPLVRVVFNTLKTSPALT* |
Ga0126314_110745691 | 3300010042 | Serpentine Soil | YLERKQAEGKSRREAIRCLKRQLVRVVFNTLKASPALT* |
Ga0126310_100251585 | 3300010044 | Serpentine Soil | KQAAGKSRREAIRCLKRLLVRVVFNTLKASPALT* |
Ga0126306_101439163 | 3300010166 | Serpentine Soil | ERKQAEGKSRREAIRCLKRQLARVVFNTLKASPTLT* |
Ga0126306_111165602 | 3300010166 | Serpentine Soil | KQAEGKSRREALRCLKRQLARTVYTTLKNEPLLT* |
Ga0134084_104749102 | 3300010322 | Grasslands Soil | LERKRAEGKSRREALRCLKRLLVRVVFNTLKASPALT* |
Ga0134086_101956591 | 3300010323 | Grasslands Soil | KRAEGKSRREALRCLRRLLVRVVFNTLEASRALT* |
Ga0126379_135669681 | 3300010366 | Tropical Forest Soil | RKRAEGKSWREAIRCLKRLLVRVVFQTLKTSPALT* |
Ga0138514_1000016098 | 3300011003 | Soil | LERKQGEGKSRREAIRCLKRQLARTVYTTLKSEPSLT* |
Ga0120163_11302121 | 3300012003 | Permafrost | AARASLARKQADGKSRREALRCLKRQLARTVYTILKSEPLLT* |
Ga0120159_10464373 | 3300012014 | Permafrost | SPPPPRPSPKRKQAEGKSKREAIRCLKRQLIRVVFNTLKASPTLT* |
Ga0136631_100215321 | 3300012043 | Polar Desert Sand | LERKQAEGKSKREAIRCLKRLLARTVFNALKASPALT* |
Ga0136638_100405371 | 3300012094 | Polar Desert Sand | RKQAEGKSRREAIRCLKRQLARTVHTILKKKPLLT* |
Ga0136620_101041451 | 3300012186 | Polar Desert Sand | LERKQAEGKSRREAIRCLKRMLVRVVFNTLKASPTLT* |
Ga0136620_102721452 | 3300012186 | Polar Desert Sand | KQAEGKSRREAIRCLKRQLARTIFNTLKASPTLT* |
Ga0137365_103069472 | 3300012201 | Vadose Zone Soil | ERKQSEGKSRREALRCLKRQLARTVYTTLKNEPLLT* |
Ga0137374_104998801 | 3300012204 | Vadose Zone Soil | KQAEGKSRREAIRCLKRQLARVVFNTLKASPALT* |
Ga0137372_103989362 | 3300012350 | Vadose Zone Soil | LERKQGEGKSRREAIRCLKRQLARTVYTTLKSESALT* |
Ga0137372_107794021 | 3300012350 | Vadose Zone Soil | KQAEGKSRREAIRCLKRQLVRVVFNTLKASPALT* |
Ga0137372_110047851 | 3300012350 | Vadose Zone Soil | KQSEGKSRREALRCLKRQLARTVYTTLKNEPLLT* |
Ga0137375_102670411 | 3300012360 | Vadose Zone Soil | ERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT* |
Ga0136616_101869672 | 3300012679 | Polar Desert Sand | KQAEGKSRREALRCLKRQLARTIFNTLKARPTLT* |
Ga0136612_103184711 | 3300012680 | Polar Desert Sand | KQAEGKSRREAIRCLKRQLARTVYTTLKANPTLT* |
Ga0162652_1000188171 | 3300012941 | Soil | AYLERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT* |
Ga0157373_112044651 | 3300013100 | Corn Rhizosphere | RKQAEGKTRREALRCLKRQLARTVYTTLKSELLLT* |
Ga0157373_112356061 | 3300013100 | Corn Rhizosphere | ERKQAEGKTRREAIRCLKRLLARVVFNTLKTSPALT* |
Ga0157374_128097042 | 3300013296 | Miscanthus Rhizosphere | ARAYLERKRGEGKSWREAIRCHKRLLVRVVFQTLKASPALT* |
Ga0120154_10414901 | 3300013501 | Permafrost | EPPPSPDRNQAEGKTRREAIRCLKRLLARAVFNTLKASPTLT* |
Ga0120154_11285721 | 3300013501 | Permafrost | SPPAPRACLERKQAEGKSKREAIRCLKRLLARTVFNTLKASPALT* |
Ga0120173_10499292 | 3300014031 | Permafrost | AYLERKQAEGKTRREAISCLKRQLARTVFNTLKANTALT* |
Ga0163163_120125752 | 3300014325 | Switchgrass Rhizosphere | MELKQTEGKSRREGLRSLKRHLARTIHTTLKNEAALT* |
Ga0134085_105990742 | 3300015359 | Grasslands Soil | MTTSSTSSRKQAEGKSRREAIRCLKRQLARTVFNTLKAGTALT* |
Ga0132257_1020551583 | 3300015373 | Arabidopsis Rhizosphere | HPPARAYLERKQNEGKSRREALHCLKRQLARTVYTTLKNEPY* |
Ga0132255_1003049991 | 3300015374 | Arabidopsis Rhizosphere | KQAEGKSRREAIRCLKRQLARTVYTTLKAEPALT* |
Ga0180121_104007722 | 3300017695 | Polar Desert Sand | ERKQAEGKTRREAIRCLKRLLARTVFNTLKASPALT |
Ga0187776_115656311 | 3300017966 | Tropical Peatland | NANAAKGKSRREALRCLKRLLVRVVYNTLKTSPALT |
Ga0184608_100162721 | 3300018028 | Groundwater Sediment | RKQGEGKTRREAIRCLKRQLARTVYTTLKNEPLLT |
Ga0184638_10093797 | 3300018052 | Groundwater Sediment | ERKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT |
Ga0184638_13270981 | 3300018052 | Groundwater Sediment | LERKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT |
Ga0184621_101568941 | 3300018054 | Groundwater Sediment | ERKQNEGKSRREAIRCLKRQLARTVYTTLKTESALT |
Ga0184632_100333121 | 3300018075 | Groundwater Sediment | RKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT |
Ga0184612_102003073 | 3300018078 | Groundwater Sediment | ERKQSEGKSRREALRCLKRQLARTVYTTLKAESALT |
Ga0190270_116573072 | 3300018469 | Soil | ERKQSEGKSRREALRCLKRQLARTIFNTLKASPALT |
Ga0190274_130696902 | 3300018476 | Soil | ERKQADGKSRREAIRCLKRQLARTIYTTLKNEPRLT |
Ga0066669_123851341 | 3300018482 | Grasslands Soil | ERKQNEGKSRREAIRCLKRQLARTIYTTLKTEPLLT |
Ga0193705_10830231 | 3300019869 | Soil | LERKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT |
Ga0193701_10793412 | 3300019875 | Soil | ERKQGEGKSRREALRCLKRLLARTVYTTLKSEALLT |
Ga0193751_10719682 | 3300019888 | Soil | AYLERKQAEGKSRREAIRCLKRLLVRVVFNTLKTSPALT |
Ga0182009_104009931 | 3300021445 | Soil | ERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT |
Ga0222622_104075321 | 3300022756 | Groundwater Sediment | RKQAEGKSRREAIRCLKRQLARAVFNTLKTSPALT |
Ga0209751_106942322 | 3300025327 | Soil | RKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT |
Ga0210142_10041991 | 3300025552 | Natural And Restored Wetlands | ERKQSEGKSRREALRCLKRQLARTVYTTLKSEPLLT |
Ga0209176_101589862 | 3300025854 | Arctic Peat Soil | LERKRADGKTKREAIRCLKRLLARTVFNTLKASAALT |
Ga0207699_114635512 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AYLDRKQNEGKTRREAIRCLKRQLARTVYTTLRDQPLLT |
Ga0207684_117472042 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ERKQGEGKSRREALRCLKRQLARTVYTTLKNEPLLT |
Ga0207652_116241781 | 3300025921 | Corn Rhizosphere | YLERKQAEGKSRREAIRCLKRLLVRVVFNTLKTSPALT |
Ga0207664_113020672 | 3300025929 | Agricultural Soil | RKQTEGKSRREAIRCLKRQLARVVFNTLKASPALT |
Ga0207690_116032152 | 3300025932 | Corn Rhizosphere | YLERKRGEGKSRREAIRCLKRLLVRVVFNTLKASPALT |
Ga0207640_120770091 | 3300025981 | Corn Rhizosphere | PARDYLERKRAEGKRMRSTRCLKRRLVRVIFNTLKASPP |
(restricted) Ga0233416_100952893 | 3300027799 | Sediment | LERKQSEGKSRREAIRCLKRQLARTVYTTLKAESALT |
Ga0209166_104918941 | 3300027857 | Surface Soil | YLDRKQAEGKSRREAIRCLKRLLIRAVYQSLKTSPTLT |
Ga0265334_101013741 | 3300028573 | Rhizosphere | RKQAEGKSRREALRCLKRQLARTIYTTLKNQPHLT |
Ga0307276_101031192 | 3300028705 | Soil | RVPTSERKQSEGKSRREALRCLKRQLARTVYTTLKKESLLT |
Ga0307313_101792622 | 3300028715 | Soil | RKQNEGKTRREAIRCLKRQLARTVYTTLKSEPLLT |
Ga0307317_100130136 | 3300028720 | Soil | RKQGEGKSRREALRCLKRLLARTVYTTLKSEALLT |
Ga0307318_102720151 | 3300028744 | Soil | ERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT |
Ga0307288_101357751 | 3300028778 | Soil | YLARKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT |
Ga0307323_102238171 | 3300028787 | Soil | LERKQGEGKTRREAIRCLKRQLARTVYTTLKNEPLLT |
Ga0307290_102204422 | 3300028791 | Soil | YLERKQGEGKTRREAIRCLKRQLARTVYTTLKNEPQLT |
Ga0307503_100046321 | 3300028802 | Soil | ERKQNEGKSRREALRCLKRQLARTVYTTLKNEPPLT |
Ga0307302_102241662 | 3300028814 | Soil | RKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT |
Ga0307296_101734183 | 3300028819 | Soil | RKQSEGKSRREALRCLKRQLARIVFNTLKASPALT |
Ga0307296_106266602 | 3300028819 | Soil | LQRKQNEGKTRREAIRCLKRQLARTVYTTLKSEPLLT |
Ga0307310_104562781 | 3300028824 | Soil | RKQNEGKTRREAIRCLKRQLARTVYTTLKTEPLLT |
Ga0307314_102032062 | 3300028872 | Soil | YLERKQNEGKSRREAIRCLKRQLARTVYTTLKTESALT |
Ga0307278_101728421 | 3300028878 | Soil | ERKQSQGKTRREAIRCLKRQLARTVYTTLKNEPLLT |
Ga0307308_102150711 | 3300028884 | Soil | RKQGEGKSRREALRCLKRQLARTVYTTLKSEALLT |
Ga0307304_101031702 | 3300028885 | Soil | VYLERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT |
Ga0307304_105636661 | 3300028885 | Soil | LERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT |
Ga0265324_102750101 | 3300029957 | Rhizosphere | ERKQAEGKSRREALRCLKRQLARTIYTTLKNQPHLT |
Ga0272433_1000071980 | 3300031450 | Rock | ARKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT |
Ga0272434_1000264143 | 3300031473 | Rock | LARKQTEGKSRREAIRCLKRQLARTVHTTLKNGPPLT |
Ga0272434_10885275 | 3300031473 | Rock | ARKQTEGKSRREAIRCLKRQLARTVHTTLKNGPPLT |
Ga0318547_104920191 | 3300031781 | Soil | ERKKAEGKSRREAIRCLKRLLVRVVFNTLKASPALT |
Ga0307406_106059681 | 3300031901 | Rhizosphere | RTQREGKSRREALRCLKRQLARTVYTTLKSEPSLT |
Ga0318525_100585861 | 3300032089 | Soil | RKQNEGKTRREAIRCLKRQLARTVYTTLKNEPLLT |
Ga0306920_1032827951 | 3300032261 | Soil | YHEGKRADGKSRREAIRCLKRLLVRVVYQTLKASPALT |
Ga0335079_116944662 | 3300032783 | Soil | ERKQGEGKSRREALRCLKRQLARTVYTTLKSEPLLT |
⦗Top⦘ |